KEGG   Homo sapiens (human): 23545Help
Entry
23545             CDS       T01001                                 

Gene name
ATP6V0A2, A2, ARCL, ARCL2A, ATP6A2, ATP6N1D, J6B7, RTF, STV1, TJ6, TJ6M, TJ6S, VPH1, WSS
Definition
ATPase, H+ transporting, lysosomal V0 subunit a2 (EC:3.6.3.6)
Orthology
K02154  
V-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Disease
H00557  
Cutis laxa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    23545 (ATP6V0A2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    23545 (ATP6V0A2)
   04142 Lysosome
    23545 (ATP6V0A2)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    23545 (ATP6V0A2)
  Nervous system
   04721 Synaptic vesicle cycle
    23545 (ATP6V0A2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    23545 (ATP6V0A2)
  Infectious diseases
   05110 Vibrio cholerae infection
    23545 (ATP6V0A2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    23545 (ATP6V0A2)
   05152 Tuberculosis
    23545 (ATP6V0A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   23545 (ATP6V0A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 856 aa AA seqDB search
MGSLFRSETMCLAQLFLQSGTAYECLSALGEKGLVQFRDLNQNVSSFQRKFVGEVKRCEE
LERILVYLVQEINRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRK
NLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPSLESDSLLDYSCMQRLGAKLGFVSGLI
NQGKVEAFEKMLWRVCKGYTIVSYAELDESLEDPETGEVIKWYVFLISFWGEQIGHKVKK
ICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSRVI
QVKKMKAIYHMLNMCSFDVTNKCLIAEVWCPEADLQDLRRALEEGSRESGATIPSFMNII
PTKETPPTRIRTNKFTEGFQNIVDAYGVGSYREVNPALFTIITFPFLFAVMFGDFGHGFV
MFLFALLLVLNENHPRLNQSQEIMRMFFNGRYILLLMGLFSVYTGLIYNDCFSKSVNLFG
SGWNVSAMYSSSHPPAEHKKMVLWNDSVVRHNSILQLDPSIPGVFRGPYPLGIDPIWNLA
TNRLTFLNSFKMKMSVILGIIHMTFGVILGIFNHLHFRKKFNIYLVSIPELLFMLCIFGY
LIFMIFYKWLVFSAETSRVAPSILIEFINMFLFPASKTSGLYTGQEYVQRVLLVVTALSV
PVLFLGKPLFLLWLHNGRSCFGVNRSGYTLIRKDSEEEVSLLGSQDIEEGNHQVEDGCRE
MACEEFNFGEILMTQVIHSIEYCLGCISNTASYLRLWALSLAHAQLSDVLWAMLMRVGLR
VDTTYGVLLLLPVIALFAVLTIFILLIMEGLSAFLHAIRLHWVEFQNKFYVGAGTKFVPF
SFSLLSSKFNNDDSVA
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggggtccctgttccggagcgagaccatgtgcctggcgcagctcttcctgcagtcgggc
acggcctacgagtgcctcagcgccctgggcgagaaaggcctggtccagttccgagacctc
aaccagaacgtaagttctttccaaagaaaatttgttggtgaggtgaagaggtgtgaagag
ctagagcgaatattggtgtatttggtacaggaaattaatagagctgatattccccttcct
gaaggagaggccagccctcctgcgccacccctgaaacaggttctagaaatgcaggagcag
ttgcagaagctcgaggttgaactgagagaagtcactaagaacaaggagaaactgaggaaa
aacttgctggaactgatagagtacactcacatgctgagagtgacaaagacctttgtgaaa
cgcaatgttgagtttgaacccacttatgaagaattcccttccttagagagtgattctttg
ttggattacagctgtatgcagaggctgggagcaaaactgggatttgtgtctggcctaatt
aaccaaggaaaagtggaagcatttgaaaaaatgttgtggagagtctgcaaagggtacacc
atcgtgtcctatgcagaactggatgaatcccttgaagaccctgaaacaggggaagtcata
aaatggtatgtctttttaatatccttttggggagagcagattggccacaaggttaagaag
atatgtgattgctaccactgccacgtgtacccctatccaaacacagccgaggagcggagg
gagatccaggaggggctgaacacccgcatccaggatctctacactgtactgcacaaaacc
gaggactatttgaggcaagtgctatgtaaagccgccgagtctgtctacagccgtgtgatc
caggtgaagaaaatgaaggccatctatcacatgctgaacatgtgcagctttgacgtgacc
aacaagtgcctcattgctgaggtctggtgtcccgaggcggatctgcaggacctgcgccgg
gcactggaggagggctcgagagagagtggtgctacaatcccctcattcatgaatataatc
cccacaaaagaaacaccccccactcggatccgcaccaacaaattcaccgagggatttcag
aacatcgtggatgcttatggagtcggaagctacagagaagtcaatccagctctctttacc
atcatcaccttcccgtttttatttgctgtgatgtttggagacttcggacatggctttgtg
atgtttttatttgccctcttgttggtgttaaatgaaaatcatcccagactaaatcagtca
caagagatcatgaggatgttttttaatggccggtacatcctcctgctgatggggctgttc
tcagtgtacactggcctcatctacaacgactgcttttcaaagtcagtcaacctgttcggc
tctgggtggaacgtgtcggccatgtacagctccagccacccacccgcagagcataagaag
atggtgctttggaatgacagcgtcgttagacacaacagcattttgcagctggatccaagc
attcctggagtgttccgaggcccttatccccttggcattgatcctatttggaacttggcc
acaaatcgcctcacttttctaaactctttcaaaatgaaaatgtccgtgattttaggaatc
attcatatgacttttggagtcattctgggaatatttaaccacttgcacttcaggaagaag
ttcaacatttacctggtttccatcccggaacttctcttcatgctctgtatctttggatac
cttatatttatgattttctacaagtggctggttttttcagcagaaacctccagagttgct
cccagcattctgattgaatttattaacatgtttttattcccagccagtaaaacaagtggc
ctttacacagggcaggagtatgtccagagagtgctgctggttgtcacagcattgtctgtc
cctgtcctcttcttgggaaagccactgtttttgttgtggcttcacaatgggcgtagttgc
ttcggggtgaaccggagtggctacacacttataaggaaagatagtgaggaagaagtttca
ttgctgggaagccaagatatagaagagggaaatcaccaggtggaagatggatgtagagaa
atggcgtgtgaagagtttaattttggagaaatattaatgacccaagtaatccattccatc
gagtactgtctgggatgcatctccaacaccgcctcctacctgaggctctgggcgcttagc
ctggctcacgcacagttgtctgatgtcctgtgggccatgctgatgcgcgtgggcctccgc
gttgacaccacctatggcgtcttgctactgctcccggttatcgcgctctttgcagttttg
accattttcatccttctgatcatggaagggctttctgcgtttcttcacgccatacgcctc
cactgggtagaatttcagaacaaattctacgttggtgcaggcaccaaatttgttcctttc
tcattcagtctactttcatcaaagttcaataacgacgacagtgtggcatga

DBGET integrated database retrieval system