KEGG   Homo sapiens (human): 23545Help
Entry
23545             CDS       T01001                                 

Gene name
ATP6V0A2, A2, ARCL, ARCL2A, ATP6A2, ATP6N1D, J6B7, RTF, STV1, TJ6, TJ6M, TJ6S, VPH1, WSS
Definition
ATPase, H+ transporting, lysosomal V0 subunit a2 (EC:3.6.3.6)
Orthology
K02154  
V-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Disease
H00557  
Cutis laxa
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
Organismal Systems; Excretory system; Collecting duct acid secretion [PATH:hsa04966]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:hsa05110]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 856 aa AA seqDB search
MGSLFRSETMCLAQLFLQSGTAYECLSALGEKGLVQFRDLNQNVSSFQRKFVGEVKRCEE
LERILVYLVQEINRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRK
NLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPSLESDSLLDYSCMQRLGAKLGFVSGLI
NQGKVEAFEKMLWRVCKGYTIVSYAELDESLEDPETGEVIKWYVFLISFWGEQIGHKVKK
ICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSRVI
QVKKMKAIYHMLNMCSFDVTNKCLIAEVWCPEADLQDLRRALEEGSRESGATIPSFMNII
PTKETPPTRIRTNKFTEGFQNIVDAYGVGSYREVNPALFTIITFPFLFAVMFGDFGHGFV
MFLFALLLVLNENHPRLNQSQEIMRMFFNGRYILLLMGLFSVYTGLIYNDCFSKSVNLFG
SGWNVSAMYSSSHPPAEHKKMVLWNDSVVRHNSILQLDPSIPGVFRGPYPLGIDPIWNLA
TNRLTFLNSFKMKMSVILGIIHMTFGVILGIFNHLHFRKKFNIYLVSIPELLFMLCIFGY
LIFMIFYKWLVFSAETSRVAPSILIEFINMFLFPASKTSGLYTGQEYVQRVLLVVTALSV
PVLFLGKPLFLLWLHNGRSCFGVNRSGYTLIRKDSEEEVSLLGSQDIEEGNHQVEDGCRE
MACEEFNFGEILMTQVIHSIEYCLGCISNTASYLRLWALSLAHAQLSDVLWAMLMRVGLR
VDTTYGVLLLLPVIALFAVLTIFILLIMEGLSAFLHAIRLHWVEFQNKFYVGAGTKFVPF
SFSLLSSKFNNDDSVA
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggggtccctgttccggagcgagaccatgtgcctggcgcagctcttcctgcagtcgggc
acggcctacgagtgcctcagcgccctgggcgagaaaggcctggtccagttccgagacctc
aaccagaacgtaagttctttccaaagaaaatttgttggtgaggtgaagaggtgtgaagag
ctagagcgaatattggtgtatttggtacaggaaattaatagagctgatattccccttcct
gaaggagaggccagccctcctgcgccacccctgaaacaggttctagaaatgcaggagcag
ttgcagaagctcgaggttgaactgagagaagtcactaagaacaaggagaaactgaggaaa
aacttgctggaactgatagagtacactcacatgctgagagtgacaaagacctttgtgaaa
cgcaatgttgagtttgaacccacttatgaagaattcccttccttagagagtgattctttg
ttggattacagctgtatgcagaggctgggagcaaaactgggatttgtgtctggcctaatt
aaccaaggaaaagtggaagcatttgaaaaaatgttgtggagagtctgcaaagggtacacc
atcgtgtcctatgcagaactggatgaatcccttgaagaccctgaaacaggggaagtcata
aaatggtatgtctttttaatatccttttggggagagcagattggccacaaggttaagaag
atatgtgattgctaccactgccacgtgtacccctatccaaacacagccgaggagcggagg
gagatccaggaggggctgaacacccgcatccaggatctctacactgtactgcacaaaacc
gaggactatttgaggcaagtgctatgtaaagccgccgagtctgtctacagccgtgtgatc
caggtgaagaaaatgaaggccatctatcacatgctgaacatgtgcagctttgacgtgacc
aacaagtgcctcattgctgaggtctggtgtcccgaggcggatctgcaggacctgcgccgg
gcactggaggagggctcgagagagagtggtgctacaatcccctcattcatgaatataatc
cccacaaaagaaacaccccccactcggatccgcaccaacaaattcaccgagggatttcag
aacatcgtggatgcttatggagtcggaagctacagagaagtcaatccagctctctttacc
atcatcaccttcccgtttttatttgctgtgatgtttggagacttcggacatggctttgtg
atgtttttatttgccctcttgttggtgttaaatgaaaatcatcccagactaaatcagtca
caagagatcatgaggatgttttttaatggccggtacatcctcctgctgatggggctgttc
tcagtgtacactggcctcatctacaacgactgcttttcaaagtcagtcaacctgttcggc
tctgggtggaacgtgtcggccatgtacagctccagccacccacccgcagagcataagaag
atggtgctttggaatgacagcgtcgttagacacaacagcattttgcagctggatccaagc
attcctggagtgttccgaggcccttatccccttggcattgatcctatttggaacttggcc
acaaatcgcctcacttttctaaactctttcaaaatgaaaatgtccgtgattttaggaatc
attcatatgacttttggagtcattctgggaatatttaaccacttgcacttcaggaagaag
ttcaacatttacctggtttccatcccggaacttctcttcatgctctgtatctttggatac
cttatatttatgattttctacaagtggctggttttttcagcagaaacctccagagttgct
cccagcattctgattgaatttattaacatgtttttattcccagccagtaaaacaagtggc
ctttacacagggcaggagtatgtccagagagtgctgctggttgtcacagcattgtctgtc
cctgtcctcttcttgggaaagccactgtttttgttgtggcttcacaatgggcgtagttgc
ttcggggtgaaccggagtggctacacacttataaggaaagatagtgaggaagaagtttca
ttgctgggaagccaagatatagaagagggaaatcaccaggtggaagatggatgtagagaa
atggcgtgtgaagagtttaattttggagaaatattaatgacccaagtaatccattccatc
gagtactgtctgggatgcatctccaacaccgcctcctacctgaggctctgggcgcttagc
ctggctcacgcacagttgtctgatgtcctgtgggccatgctgatgcgcgtgggcctccgc
gttgacaccacctatggcgtcttgctactgctcccggttatcgcgctctttgcagttttg
accattttcatccttctgatcatggaagggctttctgcgtttcttcacgccatacgcctc
cactgggtagaatttcagaacaaattctacgttggtgcaggcaccaaatttgttcctttc
tcattcagtctactttcatcaaagttcaataacgacgacagtgtggcatga

DBGET integrated database retrieval system