KEGG   Homo sapiens (human): 23560Help
Entry
23560             CDS       T01001                                 

Gene name
GTPBP4, CRFG, NGB, NOG1
Definition
(RefSeq) GTP binding protein 4
  KO
K06943  
nucleolar GTP-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    23560 (GTPBP4)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   GTPases
    23560 (GTPBP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BZE4(Tbio)
UniProt: 
Position
10p15.3
AA seq 634 aa AA seqDB search
MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHD
RLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYG
DSLYRCKQLKRAALGRMCTVIKRQKQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVG
KSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQA
ITALAHLRAAVLYVMDLSEQCGHGLREQLELFQNIRPLFINKPLIVVANKCDVKRIAELS
EDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRL
HLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLM
NLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEI
RQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYA
VQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKM
NRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggcacattacaacttcaagaaaattacggtggtgccgtccgccaaggacttcatagac
ctcacgttgtcgaagactcaacgaaagactccaaccgttattcataaacattaccaaata
catcgcattagacatttttacatgagaaaagtcaaatttactcaacagaattaccatgat
agactttcacaaattctaacagatttccccaaattggatgatattcatccgttctatgct
gatttgatgaatattctctacgacaaggatcattacaagttggctctggggcaaataaat
attgccaaaaatttagtggacaatgttgctaaagattatgtgcgactgatgaagtatggc
gactctctctaccgctgcaaacagctgaagcgtgcggccctgggacggatgtgcacagtg
atcaagaggcagaagcagagtttggagtatttggagcaagtgcgtcagcatttatcccgt
ttgccaaccattgatccgaataccaggaccctgcttttgtgtgggtacccaaatgttggg
aagtccagcttcatcaacaaggtgacgagagcagacgtggatgtccagccctatgcgttc
acaaccaagtctctgtttgttgggcacatggattataagtatctacgttggcaggttgta
gacactcctgggatcctggaccaccctctggaggataggaacaccatcgagatgcaggcc
atcactgccctggcccacctccgtgctgcggtcctgtatgtgatggatttgtctgagcag
tgtgggcatgggctgagggagcagctagaactcttccagaacatcagacctctcttcatc
aacaagcctctcatagttgtagccaacaaatgtgatgtgaagagaatagctgaactttct
gaagatgatcagaaaatatttacagatttgcagtctgaaggattccctgtaatagagacc
agcaccctgactgaggaaggtgttattaaagttaaaacagaggcttgcgataggcttttg
gctcatcgagtggaaaccaaaatgaagggaaataaagtgaatgaggtgctgaatagactg
cacctggctatcccaaccaggagggacgataaggagaggccccctttcatccctgaagga
gtggtggctcgcaggaagaggatggaaactgaggagtccaggaagaagagggaacgagat
cttgagctggaaatgggagatgattatattttggatcttcagaagtactgggatttaatg
aatttgtctgaaaaacatgataagataccagaaatctgggaaggccataatatagctgat
tatattgatccagccatcatgaagaaattggaagaattagaaaaagaagaagagctgaga
acagctgctggagagtatgacagtgtatctgagagtgaagacgaagagatgctggaaatc
cgacagctggcaaagcaaattcgagagaaaaagaagttgaaaattctggagtccaaagaa
aagaatacacagggacccaggatgccgcgaactgctaagaaggttcagaggacagttttg
gagaaggagatgcgtagtcttggtgttgacatggacgataaagacgatgcccattacgca
gtccaggcaagaagatcccggagcatcactaggaaaagaaagcgggaagactctgctccc
ccgtcctctgtggcccggagtgggagttgctctcgaactccacgtgacgtttctggtctt
agggatgtcaagatggtgaagaaagccaagactatgatgaagaatgctcagaagaagatg
aatcggttggggaagaaaggggaggcggatagacacgtgtttgatatgaagcccaagcac
ttgctgtctgggaagaggaaagctggtaaaaaggacaggagatag

DBGET integrated database retrieval system