KEGG   Homo sapiens (human): 23566Help
Entry
23566             CDS       T01001                                 

Gene name
LPAR3, EDG7, Edg-7, GPCR, HOFNH30, LP-A3, LPA3, RP4-678I3
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  
lysophosphatidic acid receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    23566 (LPAR3)
   04072 Phospholipase D signaling pathway
    23566 (LPAR3)
   04151 PI3K-Akt signaling pathway
    23566 (LPAR3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    23566 (LPAR3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23566 (LPAR3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Lysophosphatidic acid [OT]
    23566 (LPAR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p22.3
AA seq 353 aa AA seqDB search
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagtgtcactatgacaagcacatggactttttttataataggagcaacactgat
actgtcgatgactggacaggaacaaagcttgtgattgttttgtgtgttgggacgtttttc
tgcctgtttatttttttttctaattctctggtcatcgcggcagtgatcaaaaacagaaaa
tttcatttccccttctactacctgttggctaatttagctgctgccgatttcttcgctgga
attgcctatgtattcctgatgtttaacacaggcccagtttcaaaaactttgactgtcaac
cgctggtttctccgtcaggggcttctggacagtagcttgactgcttccctcaccaacttg
ctggttatcgccgtggagaggcacatgtcaatcatgaggatgcgggtccatagcaacctg
accaaaaagagggtgacactgctcattttgcttgtctgggccatcgccatttttatgggg
gcggtccccacactgggctggaattgcctctgcaacatctctgcctgctcttccctggcc
cccatttacagcaggagttaccttgttttctggacagtgtccaacctcatggccttcctc
atcatggttgtggtgtacctgcggatctacgtgtacgtcaagaggaaaaccaacgtcttg
tctccgcatacaagtgggtccatcagccgccggaggacacccatgaagctaatgaagacg
gtgatgactgtcttaggggcgtttgtggtatgctggaccccgggcctggtggttctgctc
ctcgacggcctgaactgcaggcagtgtggcgtgcagcatgtgaaaaggtggttcctgctg
ctggcgctgctcaactccgtcgtgaaccccatcatctactcctacaaggacgaggacatg
tatggcaccatgaagaagatgatctgctgcttctctcaggagaacccagagaggcgtccc
tctcgcatcccctccacagtcctcagcaggagtgacacaggcagccagtacatagaggat
agtattagccaaggtgcagtctgcaataaaagcacttcctaa

DBGET integrated database retrieval system