KEGG   Homo sapiens (human): 23569Help
Entry
23569             CDS       T01001                                 

Gene name
PADI4, PAD, PAD4, PADI5, PDI4, PDI5
Definition
peptidyl arginine deiminase, type IV (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     23569 (PADI4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.13
AA seq 663 aa AA seqDB search
MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKK
KSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCAD
ITRTGKVKPTRAVKDQRTWTWGPCGQGAILLVNCDRDNLESSAMDCEDDEVLDSEDLQDM
SLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMV
PGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTP
NTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQDEMEIGYIQAP
HKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRG
KEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVP
APDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNS
FVERCIDWNRELLKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPK
PFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHIRHGEVHCGTNVRRKPFSFKWWN
MVP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggggacattgatccgtgtgaccccagagcagcccacccatgccgtgtgtgtg
ctgggcaccttgactcagcttgacatctgcagctctgcccctgaggactgcacgtccttc
agcatcaacgcctccccaggggtggtcgtggatattgcccacggccctccagccaagaag
aaatccacaggttcctccacatggcccctggaccctggggtagaggtgaccctgacgatg
aaagtggccagtggtagcacaggcgaccagaaggttcagatttcatactacggacccaag
actccaccagtcaaagctctactctacctcaccggggtggaaatctccttgtgcgcagac
atcacccgcaccggcaaagtgaagccaaccagagctgtgaaagatcagaggacctggacc
tggggcccttgtggacagggtgccatcctgctggtgaactgtgacagagacaatctcgaa
tcttctgccatggactgcgaggatgatgaagtgcttgacagcgaagacctgcaggacatg
tcgctgatgaccctgagcacgaagacccccaaggacttcttcacaaaccatacactggtg
ctccacgtggccaggtctgagatggacaaagtgagggtgtttcaggccacacggggcaaa
ctgtcctccaagtgcagcgtagtcttgggtcccaagtggccctctcactacctgatggtc
cccggtggaaagcacaacatggacttctacgtggaggccctcgctttcccggacaccgac
ttcccggggctcattaccctcaccatctccctgctggacacgtccaacctggagctcccc
gaggctgtggtgttccaagacagcgtggtcttccgcgtggcgccctggatcatgaccccc
aacacccagcccccgcaggaggtgtacgcgtgcagtatttttgaaaatgaggacttcctg
aagtcagtgactactctggccatgaaagccaagtgcaagctgaccatctgccctgaggag
gagaacatggatgaccagtggatgcaggatgaaatggagatcggctacatccaagcccca
cacaaaacgctgcccgtggtcttcgactctccaaggaacagaggcctgaaggagtttccc
atcaaacgcgtgatgggtccagattttggctatgtaactcgagggccccaaacagggggt
atcagtggactggactcctttgggaacctggaagtgagccccccagtcacagtcaggggc
aaggaatacccgctgggcaggattctcttcggggacagctgttatcccagcaatgacagc
cggcagatgcaccaggccctgcaggacttcctcagtgcccagcaggtgcaggcccctgtg
aagctctattctgactggctgtccgtgggccacgtggacgagttcctgagctttgtgcca
gcacccgacaggaagggcttccggctgctcctggccagccccaggtcctgctacaaactg
ttccaggagcagcagaatgagggccacggggaggccctgctgttcgaagggatcaagaaa
aaaaaacagcagaaaataaagaacattctgtcaaacaagacattgagagaacataattca
tttgtggagagatgcatcgactggaaccgcgagctgctgaagcgggagctgggcctggcc
gagagtgacatcattgacatcccgcagctcttcaagctcaaagagttctctaaggcggaa
gcttttttccccaacatggtgaacatgctggtgctagggaagcacctgggcatccccaag
cccttcgggcccgtcatcaacggccgctgctgcctggaggagaaggtgtgttccctgctg
gagccactgggcctccagtgcaccttcatcaacgacttcttcacctaccacatcaggcat
ggggaggtgcactgcggcaccaacgtgcgcagaaagcccttctccttcaagtggtggaac
atggtgccctga

DBGET integrated database retrieval system