KEGG   Homo sapiens (human): 23583Help
Entry
23583             CDS       T01001                                 

Gene name
SMUG1, FDG, HMUDG, UNG3
Definition
single-strand-selective monofunctional uracil-DNA glycosylase 1
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    23583 (SMUG1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     23583 (SMUG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.13
AA seq 270 aa AA seqDB search
MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEY
AWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQE
HPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPA
ELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHP
SPRNPQANKGWEAVAKERLNELGLLPLLLK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggctttcctgctggggtccatccatgagcctgcaggtgccctcatggagccc
cagccctgccctggaagcttggctgagagcttcctggaggaggagcttcggctcaatgct
gagctgagccagctgcagttttcggagcctgtgggcatcatctacaatcccgtggagtat
gcatgggagccacatcgcaactacgtgactcgctactgccagggccccaaggaagtactc
ttcctgggcatgaaccctggaccttttggcatggcccagactggggtgccctttggggaa
gtaagcatggtccgggactggttgggcattgtggggcctgtgctgacccctccccaagag
catcctaaacgaccagtgctgggactggagtgcccacagtcagaagtgagtggtgcccga
ttctggggctttttccggaacctctgtggacagcctgaggtcttcttccatcactgtttt
gtccacaatctatgccctctgcttttcctggctcccagcgggcgcaaccttactcctgct
gagctgcctgccaagcagcgagaacagcttcttgggatctgtgatgcagccctctgccgg
caggtgcagctgctgggggtgcggctggtggtgggagttgggcgactggcagagcagcgg
gcacgacgggctctggcaggcctgatgccagaggtccaggtggaagggctcctgcatccc
tctccccgtaacccacaggccaacaagggctgggaggcagtggccaaggaaagattgaat
gagctggggctgctgccactgctgttgaaatga

DBGET integrated database retrieval system