KEGG   Homo sapiens (human): 23586Help
Entry
23586             CDS       T01001                                 

Gene name
DDX58, RIG-I, RIGI, RLR-1
Definition
DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (EC:3.6.4.13)
Orthology
K12646  
ATP-dependent RNA helicase DDX58 [EC:3.6.3.14]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    23586 (DDX58)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    23586 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    23586 (DDX58)
 Human Diseases
  Infectious diseases
   05162 Measles
    23586 (DDX58)
   05164 Influenza A
    23586 (DDX58)
   05161 Hepatitis B
    23586 (DDX58)
   05160 Hepatitis C
    23586 (DDX58)
   05168 Herpes simplex infection
    23586 (DDX58)
   05169 Epstein-Barr virus infection
    23586 (DDX58)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     23586 (DDX58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p12
AA seq 925 aa AA seqDB search
MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKF
LLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIP
TDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERN
KFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSP
FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQI
PVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTI
PSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNT
DEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMR
DTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFL
YTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESV
SRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGI
LTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGN
VIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKI
LHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKE
CFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATG
VQTLYSKWKDFHFEKIPFDPAEMSK
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgagcagcgacgcagcctgcaagccttccaggattatatccggaagaccctg
gaccctacctacatcctgagctacatggccccctggtttagggaggaagaggtgcagtat
attcaggctgagaaaaacaacaagggcccaatggaggctgccacactttttctcaagttc
ctgttggagctccaggaggaaggctggttccgtggctttttggatgccctagaccatgca
ggttattctggactttatgaagccattgaaagttgggatttcaaaaaaattgaaaagttg
gaggagtatagattacttttaaaacgtttacaaccagaatttaaaaccagaattatccca
accgatatcatttctgatctgtctgaatgtttaattaatcaggaatgtgaagaaattcta
cagatttgctctactaaggggatgatggcaggtgcagagaaattggtggaatgccttctc
agatcagacaaggaaaactggcccaaaactttgaaacttgctttggagaaagaaaggaac
aagttcagtgaactgtggattgtagagaaaggtataaaagatgttgaaacagaagatctt
gaggataagatggaaacttctgacatacagattttctaccaagaagatccagaatgccag
aatcttagtgagaattcatgtccaccttcagaagtgtctgatacaaacttgtacagccca
tttaaaccaagaaattaccaattagagcttgctttgcctgctatgaaaggaaaaaacaca
ataatatgtgctcctacaggttgtggaaaaacctttgtttcactgcttatatgtgaacat
catcttaaaaaattcccacaaggacaaaaggggaaagttgtcttttttgcgaatcagatc
ccagtgtatgaacagcagaaatctgtattctcaaaatactttgaaagacatgggtataga
gttacaggcatttctggagcaacagctgagaatgtcccagtggaacagattgttgagaac
aatgacatcatcattttaactccacagattcttgtgaacaaccttaaaaagggaacgatt
ccatcactatccatctttactttgatgatatttgatgaatgccacaacactagtaaacaa
cacccgtacaatatgatcatgtttaattatctagatcagaaacttggaggatcttcaggc
ccactgccccaggtcattgggctgactgcctcggttggtgttggggatgccaaaaacaca
gatgaagccttggattatatctgcaagctgtgtgcttctcttgatgcgtcagtgatagca
acagtcaaacacaatctggaggaactggagcaagttgtttataagccccagaagtttttc
aggaaagtggaatcacggattagcgacaaatttaaatacatcatagctcagctgatgagg
gacacagagagtctggcaaagagaatctgcaaagacctcgaaaacttatctcaaattcaa
aatagggaatttggaacacagaaatatgaacaatggattgttacagttcagaaagcatgc
atggtgttccagatgccagacaaagatgaagagagcaggatttgtaaagccctgttttta
tacacttcacatttgcggaaatataatgatgccctcattatcagtgagcatgcacgaatg
aaagatgctctggattacttgaaagacttcttcagcaatgtccgagcagcaggattcgat
gagattgagcaagatcttactcagagatttgaagaaaagctgcaggaactagaaagtgtt
tccagggatcccagcaatgagaatcctaaacttgaagacctctgcttcatcttacaagaa
gagtaccacttaaacccagagacaataacaattctctttgtgaaaaccagagcacttgtg
gacgctttaaaaaattggattgaaggaaatcctaaactcagttttctaaaacctggcata
ttgactggacgtggcaaaacaaatcagaacacaggaatgaccctcccggcacagaagtgt
atattggatgcattcaaagccagtggagatcacaatattctgattgccacctcagttgct
gatgaaggcattgacattgcacagtgcaatcttgtcatcctttatgagtatgtgggcaat
gtcatcaaaatgatccaaaccagaggcagaggaagagcaagaggtagcaagtgcttcctt
ctgactagtaatgctggtgtaattgaaaaagaacaaataaacatgtacaaagaaaaaatg
atgaatgactctattttacgccttcagacatgggacgaagcagtatttagggaaaagatt
ctgcatatacagactcatgaaaaattcatcagagatagtcaagaaaaaccaaaacctgta
cctgataaggaaaataaaaaactgctctgcagaaagtgcaaagccttggcatgttacaca
gctgacgtaagagtgatagaggaatgccattacactgtgcttggagatgcttttaaggaa
tgctttgtgagtagaccacatcccaagccaaagcagttttcaagttttgaaaaaagagca
aagatattctgtgcccgacagaactgcagccatgactggggaatccatgtgaagtacaag
acatttgagattccagttataaaaattgaaagttttgtggtggaggatattgcaactgga
gttcagacactgtactcgaagtggaaggactttcattttgagaagataccatttgatcca
gcagaaatgtccaaatga

DBGET integrated database retrieval system