KEGG   Homo sapiens (human): 2359Help
Entry
2359              CDS       T01001                                 

Gene name
FPR3, FML2_HUMAN, FMLPY, FPRH1, FPRH2, FPRL2, RMLP-R-I
Definition
formyl peptide receptor 3
Orthology
K04173  
formyl peptide receptor-like
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2359 (FPR3)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    2359 (FPR3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   fMet-Leu-Phe
    2359 (FPR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3-q13.4
AA seq 353 aa AA seqDB search
METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVN
TICYLNLALADFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIA
LDRCICVLHPAWAQNHRTMSLAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNF
AFWGDTAVERLNVFITMAKVFLILHFIIGFSVPMSIITVCYGIIAAKIHRNHMIKSSRPL
RVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPI
LYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaacttctccattcctctgaatgaaactgaggaggtgctccctgagcctgct
ggccacaccgttctgtggatcttctcattgctagtccacggagtcacctttgtcttcggg
gtcctgggcaatgggcttgtgatctgggtggctggattccggatgacacgcacagtcaac
accatctgttacctgaacctggccctagctgacttctctttcagtgccatcctaccattc
cgaatggtctcagtcgccatgagagaaaaatggccttttggctcattcctatgtaagtta
gttcatgttatgatagacatcaacctgtttgtcagtgtctacctgatcaccatcattgct
ctggaccgctgtatttgtgtcctgcatccagcctgggcccagaaccatcgcaccatgagt
ctggccaagagggtgatgacgggactctggattttcaccatagtccttaccttaccaaat
ttcatcttctggactacaataagtactacgaatggggacacatactgtattttcaacttt
gcattctggggtgacactgctgtagagaggttgaacgtgttcattaccatggccaaggtc
tttctgatcctccacttcattattggcttcagcgtgcctatgtccatcatcacagtctgc
tatgggatcatcgctgccaaaattcacagaaaccacatgattaaatccagccgtccctta
cgtgtcttcgctgctgtggtggcttctttcttcatctgttggttcccttatgaactaatt
ggcattctaatggcagtctggctcaaagagatgttgttaaatggcaaatacaaaatcatt
cttgtcctgattaacccaacaagctccttggccttttttaacagctgcctcaacccaatt
ctctacgtctttatgggtcgtaacttccaagaaagactgattcgctctttgcccactagt
ttggagagggccctgactgaggtccctgactcagcccagaccagcaacacagacaccact
tctgcttcacctcctgaggagacggagttacaagcaatgtga

DBGET integrated database retrieval system