KEGG   Homo sapiens (human): 23594Help
Entry
23594             CDS       T01001                                 

Gene name
ORC6, ORC6L
Definition
origin recognition complex, subunit 6
Orthology
K02608  
origin recognition complex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Module
Origin recognition complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    23594 (ORC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q12
AA seq 252 aa AA seqDB search
MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMK
CPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKS
YESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLE
KIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKIL
ENAASAQKATAE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggggtcggagctgatcgggcgcctagccccgcgcctgggcctcgccgagcccgacatg
ctgaggaaagcagaggagtacttgcgcctgtcccgggtgaagtgtgtcggcctctccgca
cgcaccacggagaccagcagtgcagtcatgtgcctggaccttgcagcttcctggatgaag
tgccccttggacagggcttatttaattaaactttctggtttgaacaaggagacatatcag
agctgtcttaaatcttttgagtgtttactgggcctgaattcaaatattggaataagagac
ctagctgtacagtttagctgtatagaagcagtgaacatggcttcaaagatactaaaaagc
tatgagtccagtcttccccagacacagcaagtggatcttgacttatccaggccacttttc
acttctgctgcactgctttcagcatgcaagattctaaagctgaaagtggataaaaacaaa
atggtagccacatccggtgtaaaaaaagctatatttgatcgactgtgtaaacaactagag
aagattggacagcaggtcgacagagaacctggagatgtagctactccaccacggaagaga
aagaagatagtggttgaagccccagcaaaggaaatggagaaggtagaggagatgccacat
aaaccacagaaagatgaagatctgacacaggattatgaagaatggaaaagaaaaattttg
gaaaatgctgccagtgctcaaaaggctacagcagagtga

DBGET integrated database retrieval system