KEGG   Homo sapiens (human): 23595Help
Entry
23595             CDS       T01001                                 

Gene name
ORC3, LAT, LATHEO, ORC3L
Definition
origin recognition complex, subunit 3
Orthology
K02605  
origin recognition complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Module
Origin recognition complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    23595 (ORC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q14.3-q16.1
AA seq 568 aa AA seqDB search
MKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKK
RTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEFPLILIFGIATSPIIIHRLL
PHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPFKINEKVLQVLTNIFLYHDFSVQN
FIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSNNQCENIRRLPSFRRYVEKQASEK
QVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLHKFTSSLPKYPLGRQIRELYCTCL
EKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFKSYCENHLGSTAKRIEEFLAQFQS
LDETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKELRRSKKQTKFEVLRENVVNFIDCLV
REYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALHTALNNPYYYLKNEALKSEEGCIP
NIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDANSATSEEMNEIIHARFIRA
VSELELLGFIKPTKQKTDHVARLTWGGC
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttttgcaaaagttgatctcacagttgatggactgctgtgtagatataaaa
tccaaagaggaggaaagtgttcacgtcacccaaagaaagacacattattcaatggattca
ctttccagttggtatatgactgtcacacagaagacggacccaaaaatgctaagcaaaaaa
aggactacttctagccaatggcagtctcctcctgttgtcgttatcttgaaggatatggaa
agctttgccacaaaagtactacaagacttcataattatcagcagtcaacatctccatgaa
tttccactaatactcatttttggaatagccacatctcctattatcatccaccgattgctt
cctcatgcagtatcatctctattgtgcatagaactgttccaatctttgtcttgtaaggag
cacctgactacggtactcgataagctacttcttacaactcagtttccctttaaaataaat
gaaaaagtattacaggttctgaccaacatctttttgtatcatgatttctcagttcaaaac
tttataaaaggacttcagctttctctattagagcatttctattcccagcccttaagtgtc
ctgtgctgtaatcttccagaagccaaaagaagaataaattttttatcaaataatcaatgt
gaaaacatccgacgtctaccatcttttaggaggtacgtggaaaagcaagcttcagaaaag
caagttgcgctcttgaccaatgagagatatttgaaggaggaaacacaattattactagaa
aacctgcatgtttatcatatgaattacttcctggttttgagatgtcttcataagttcacc
tcttctcttcccaagtatccactaggtcgacagatcagagagttgtactgtacatgttta
gaaaagaacatatgggattcagaggagtatgcatcagtcttgcagctgctgaggatgttg
gcaaaggatgaactgatgaccatacttgagaaatgtttcaaggtttttaagtcttattgt
gaaaaccaccttggcagcacagctaagagaatagaggagttcctggcccagtttcagagc
ctcgatgaaaccaaagaggaagaagatgcttctgggtcacagccaaaggggcttcagaag
acagacctctatcatcttcagaagtccttattggaaatgaaggagttaagaagaagtaag
aagcaaaccaaatttgaagtactcagagaaaatgttgtgaacttcattgactgtctagtg
agagaataccttctgcctcctgagacacagcctctccatgaggtggtgtacttcagtgct
gcccatgcccttcgtgagcatttaaatgctgctccgcgaattgccctccatactgcactc
aacaatccttactattatctcaagaatgaagcactgaaaagcgaagaaggctgcattccg
aatatcgccccagacatctgcatagcatacaaactgcacctagagtgtagcaggctcatc
aacctcgtggactggtcagaggcttttgcaacagttgtgacagctgctgaaaaaatggat
gcaaattctgcaacctcagaagaaatgaatgaaattatccatgctcggtttattagagct
gtttctgaactagaacttttaggatttataaaacctaccaaacagaagactgaccatgtg
gcaagactaacatggggaggctgctag

DBGET integrated database retrieval system