KEGG   Homo sapiens (human): 23604Help
Entry
23604             CDS       T01001                                 

Gene name
DAPK2, DRP-1, DRP1
Definition
death-associated protein kinase 2 (EC:2.7.11.1)
Orthology
K08803  
death-associated protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23604 (DAPK2)
   05219 Bladder cancer
    23604 (DAPK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23604 (DAPK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  DAPK family
   23604 (DAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q22.31
AA seq 370 aa AA seqDB search
MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSR
ASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKES
LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIED
GVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANIT
AVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESV
VNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESDTEEDIARRKA
LHPRRRSSTS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggcctcaatgaggagtccaaacatggagccattcaagcagcagaaggtggag
gacttttatgacatcggagaggagctggggagtggccagtttgccatcgtgaagaagtgc
cgggagaagagcacggggcttgagtatgcagccaagttcatcaagaagcggcagagccgg
gcgagccggcgcggtgtgagccgggaggagatcgagcgggaggtgagcatcctgcggcag
gtgctgcaccacaatgtcatcacgctgcacgacgtctatgagaaccgcaccgacgtggtg
ctcatccttgagctagtgtctggaggagagctcttcgatttcctggcccagaaggagtca
ctgagtgaggaggaggccaccagcttcattaagcagatcctggatggggtgaactacctt
cacacaaagaaaattgctcactttgatctcaagccagaaaacattatgttgttagacaag
aatattcccattccacacatcaagctgattgactttggtctggctcacgaaatagaagat
ggagttgaatttaagaatatttttgggacgccggaatttgttgctccagaaattgtgaac
tacgagcccctgggtctggaggctgacatgtggagcataggcgtcatcacctacatcctc
ttaagtggagcatcccctttcctgggagacacgaagcaggaaacactggcaaatatcaca
gcagtgagttacgactttgatgaggaattcttcagccagacgagcgagctggccaaggac
tttattcggaagcttctggttaaagagacccggaaacggctcacaatccaagaggctctc
agacacccctggatcacgccggtggacaaccagcaagccatggtgcgcagggagtctgtg
gtcaatctggagaacttcaggaagcagtatgtccgcaggcggtggaagctttccttcagc
atcgtgtccctgtgcaaccacctcacccgctcgctgatgaagaaggtgcacctgaggccg
gatgaggacctgaggaactgtgagagtgacactgaggaggacatcgccaggaggaaagcc
ctccacccacggaggaggagcagcacctcctaa

DBGET integrated database retrieval system