KEGG   Homo sapiens (human): 23607Help
Entry
23607             CDS       T01001                                 

Gene name
CD2AP, CMS
Definition
CD2-associated protein
Orthology
K13738  
CD2-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
Bacterial invasion of epithelial cells
Disease
H00626  
Nephrotic syndrome and focal segmental glomerulosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    23607 (CD2AP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   23607 (CD2AP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p12
AA seq 639 aa AA seqDB search
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE
TEFKDDSLPIKRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYI
PQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDS
ETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKK
PEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLIS
KETGEAGWWRGELNGKEGVFPDNFAVQINELDKDFPKPKKPPPPAKAPAPKPELIAAEKK
YFSLKPEEKDEKSTLEQKPSKPAAPQVPPKKPTPPTKASNLLRSSGTVYPKRPEKPVPPP
PPIAKINGEVSSISSKFETEPVSKLKLDSEQLPLRPKSVDFDSLTVRTSKETDVVNFDDI
ASSENLLHLTANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKDTC
YSPKPSVYLSTPSSASKANTTAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEAL
KKDHGKELEKLRKDLEEEKTMRSNLEMEIEKLKKAVLSS
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggttgactatattgtggagtatgactatgatgctgtacatgatgatgaattaactatt
cgagttggagaaatcatcaggaatgtgaaaaagctacaggaggaagggtggctggaagga
gaactaaatgggagaagaggaatgttccctgacaatttcgttaaggaaattaaaagagag
acggaattcaaggatgacagtttgcccatcaaacgggaaaggcatgggaatgtagcaagt
cttgtacaacgaataagcacctatggacttccagctggaggaattcagccacatccacaa
accaaaaacattaagaagaagaccaagaagcgtcagtgtaaagttctttttgagtacatt
ccacaaaatgaggatgaactggagctgaaagtgggagatattattgatattaatgaagag
gtagaagaaggctggtggagtggaaccctgaataacaagttgggactgtttccctcaaat
tttgtgaaagaattagaggtaacagatgatggtgaaactcatgaagcccaggacgattca
gaaactgttttggctgggcctacttcacctataccttctctgggaaatgtgagtgaaact
gcatctggatcagttacacagccaaagaaaattcgaggaattggatttggagacattttt
aaagaaggctctgtgaaacttcggacaagaacatccagtagtgaaacagaagagaaaaaa
ccagaaaagcccttaatcctacagtcactgggacccaaaactcagagtgtggagataaca
aaaacagataccgaaggtaaaattaaagctaaagaatattgtagaacattatttgcctat
gaaggtactaatgaagatgaacttacttttaaagagggggagataatccatttgataagt
aaggagactggagaagctggctggtggaggggcgaacttaatggtaaagaaggagtattt
ccagacaattttgctgtccagataaatgaacttgataaagactttccaaaaccaaagaaa
ccaccacctcctgctaaggctccagctccaaagcctgaactgatagctgcagagaagaaa
tatttttctttaaagcctgaagaaaaggatgaaaaatcaacactggaacagaaaccttct
aaaccagcagctccacaagtcccacccaagaaacctactccacctaccaaagccagtaat
ttactgagatcttctggaacagtgtacccaaagcgacctgaaaaaccagttcctccacca
cctcctatagccaagattaatggggaagtttctagcatttcatcaaaatttgaaactgag
ccagtatcaaaactaaagctagattctgaacagctgccccttagaccaaaatcagtagac
tttgattcacttacagtaaggacctccaaagaaacagatgttgtaaattttgatgacata
gcttcctcagaaaacttgcttcatctcactgcaaatagaccaaagatgcctggaagaagg
ttgccgggccgtttcaatggtggacattctccaactcacagccccgaaaaaatcttgaag
ttaccaaaagaagaagacagtgccaacctgaagccatctgaattaaaaaaagatacatgc
tactctccaaagccatctgtgtacctttcaacaccttccagtgcttctaaagcaaataca
actgctttcctgactccattagaaatcaaagctaaagtggaaacagatgatgtgaaaaaa
aattccctggatgaacttagagcccagattattgaattgttgtgcattgtagaagcactg
aaaaaggatcacgggaaagaactggaaaaactgcgaaaagatttggaagaagagaagaca
atgagaagtaatctagagatggaaatagagaagctgaaaaaagctgtcctgtcttcttga

DBGET integrated database retrieval system