KEGG   Homo sapiens (human): 23617Help
Entry
23617             CDS       T01001                                 

Gene name
TSSK2, DGS-G, SPOGA2, STK22B, TSK2
Definition
(RefSeq) testis specific serine kinase 2 (EC:2.7.11.1)
  KO
K08811  
testis-specific serine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23617 (TSSK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  TSSK family
   23617 (TSSK2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    23617 (TSSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 358 aa AA seqDB search
MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPRE
MDILATVNHGSIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQL
SSAVKYCHDLDIVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAA
YAAPEVLQSIPYQPKVYDIWSLGVILYIMVCGSMPYDDSDIRKMLRIQKEHRVDFPRSKN
LTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD
TKTGLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAST
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggacgatgccacagtcctaaggaagaagggttacatcgtaggcatcaatcttggcaag
ggttcctacgcaaaagtcaaatctgcctactctgagcgcctcaagttcaatgtggctgtc
aagatcatcgaccgcaagaaaacacctactgactttgtggagagattccttcctcgggag
atggacatcctggcaactgtcaaccacggctccatcatcaagacttacgagatctttgag
acctctgacggacggatctacatcatcatggagcttggcgtccagggcgacctcctcgag
ttcatcaagtgccagggagccctgcatgaggacgtggcacgcaagatgttccgacagctc
tcctccgccgtcaagtactgccacgacctggacatcgtccaccgggacctcaagtgcgag
aaccttctcctcgacaaggacttcaacatcaagctgtctgactttggcttctccaagcgc
tgcctgcgggacagcaatgggcgcatcatcctcagcaagaccttctgcgggtcggcagca
tatgcagcccccgaggtgctgcagagcatcccctaccagcccaaggtgtatgacatctgg
agcctgggcgtgatcctgtacatcatggtctgcggctccatgccctatgacgactccgac
atcaggaagatgctgcgtatccagaaggagcaccgtgtggacttcccgcgctccaagaac
ctgacctgcgagtgcaaggacctcatctaccgcatgctgcagcccgacgtcagccagcgg
ctccacatcgatgagatcctcagccactcgtggctgcagccccccaagcccaaagccacg
tcttctgcctccttcaagagggagggggagggcaagtaccgcgctgagtgcaaactggac
accaagacaggcttgaggcccgaccaccggcccgaccacaagcttggagccaaaacccag
caccggctgctggtggtgcccgagaacgagaacaggatggaggacaggctggccgagacc
tccagggccaaagaccatcacatctccggagctgaggtggggaaagcaagcacctag

DBGET integrated database retrieval system