KEGG   Homo sapiens (human): 23620Help
Entry
23620             CDS       T01001                                 

Gene name
NTSR2, NTR2
Definition
neurotensin receptor 2
Orthology
K04212  
neurotensin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p25.1
AA seq 410 aa AA seqDB search
METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSVHVVLKA
RAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAY
ATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHEL
ETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQV
PSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR
AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNA
VSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccagcagcccgcggcccccgcggcccagctccaacccggggctgagcctggac
gcccggctgggcgtggacactcgcctctgggccaaggtgctgttcaccgcgctctacgca
ctcatctgggcgctgggcgcggcgggcaatgcgctgtccgtgcacgtggtgctgaaggcg
cgggccgggcgcgcggggcgcctgcgccaccacgtgctcagcctggcgctcgcgggcctg
ctgctgctgctggtcggcgtgccggtggagctctacagcttcgtgtggttccactacccc
tgggtcttcggcgacctgggctgccgcggctactacttcgtgcacgagctgtgcgcctac
gccacggtgctgagcgtggcaggcctgagcgccgagcgctgcctagccgtgtgccagccc
ctgcgtgcccgcagcctgctgacgccacgccggacccggtggctggtggcgctctcgtgg
gccgcctcgctcggcctcgccctgcccatggccgtcatcatggggcagaagcacgaactc
gagacggcggacggggagccggagcccgcctcgcgagtgtgcacggtgctggtgagccgc
accgcgctccaagtctttatccaggtgaatgtgctggtgtccttcgtgctccccttggca
ctaactgctttcctgaatggggtcacagtgagccacctgctggccctctgctcccaagtg
ccgtccacttctaccccgggcagctccacccccagccgcctggagctgctgagtgaggag
ggtctcctcagcttcatcgtatggaagaagacctttatccagggaggccaggtcagcctg
gtgagacataaagacgtgcgccggatccgcagcctccagcgcagcgtccaggttctcaga
gccatcgtggtcatgtatgtcatctgctggctgccgtaccatgcccgcaggctcatgtac
tgctacgtacctgatgacgcgtggactgacccactgtacaatttctaccactacttctac
atggtgaccaacacacttttctacgtcagctcagctgtgactcctcttctctacaacgcc
gtgtcctcctccttcagaaaactcttcctggaagccgtcagctccctgtgtggagagcac
caccccatgaagcggttacccccgaagccccagagtcccaccctaatggatacagcttca
ggctttggggatcccccagaaacccggacctga

DBGET integrated database retrieval system