KEGG   Homo sapiens (human): 23621Help
Entry
23621             CDS       T01001                                 

Gene name
BACE1, ASP2, BACE, HSPC104
Definition
(RefSeq) beta-secretase 1 (EC:3.4.23.46)
  KO
K04521  
beta-site APP-cleaving enzyme 1 (memapsin 2) [EC:3.4.23.46]
Organism
hsa  Homo sapiens (human)
Pathway
Alzheimer's disease
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    23621 (BACE1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.46  memapsin 2
     23621 (BACE1)
Peptidases [BR:hsa01002]
 Aspartic Peptidases
  Family A1: pepsin family
   23621 (BACE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 
4L7G 3VF3 5HDZ 4B78 4DJX 2QP8 5F01 3VEU 5HE4 3L5E 5HE5 4FM7 5HDU 4R91 4FGX 5HDX 4IVT 4H3J 4B70 4B72 3TPP 2WF0 2WF1 2VJ9 2VIZ 3TPJ 5I3V 5HD0 4ZSR 4L7J 4D89 2QMD 4ZPE 4LC7 4I0E 4H3F 4FRS 4D88 3UQU 3UQX 3UDH 3L5F 3KMX 2WEZ 2PH8 2IQG 2B8L 5HDV 5HE7 4R92 4R93 3CIB 4DJV 2XFI 3ZMG 4FS4 4ACU 3L5D 3CIC 2QMF 1W50 4FCO 4X7I 4J0Y 3VG1 3UQP 4RCF 4J1E 4I12 4I0G 4AZY 3LPJ 2VNM 4ZPF 4XKX 4RRN 4RRO 4RRS 4R5N 4PZW 4PZX 4N00 4JP9 4JPC 4JPE 4JOO 4I0F 4HZT 4B77 4GMI 4B05 4EXG 4EWO 4DVF 4DPF 4DJU 3UDJ 3OOZ 2XFJ 2XFK 3MSJ 3LNK 3L58 3L5B 3L5C 3IVH 3INH 2WF2 2WF4 3CID 2VJ6 2QZK 2QZL 2P8H 2OAH 2NTR 2IRZ 2B8V 1TQF 4J17 2VIY 4HA5 4B00 4YBI 5I3X 4WTU 4L7H 4H3G 3INF 2ZHV 4XXS 4DJY 2G94 4B0Q 2VNN 4I11 2QMG 5EZX 4RCD 4R8Y 4H1E 4FM8 4DPI 4DJW 3UFL 3KMY 3KN0 3FKT 2ZJM 1XN2 1FKN 4ZSP 4KE1 4I0D 3LPK 4J0V 3UDM 5F00 4LXA 4B1C 4B1D 4B1E 4FRJ 3UDP 3UDR 4ZSM 4H3I 4J0P 3DUY 4WY1 4R95 4I0J 4ZPG 4I1C 4GID 4DI2 4ACX 3UDY 3MSK 3L59 3K5G 3INE 3IN3 2ZDZ 2QU3 2PH6 1XN3 1SGZ 4J1C 3OHH 4LXK 4J1I 4J0T 3VV6 3LPI 2VKM 1YM2 4I10 4D8C 4DV9 2WF3 5EZZ 4WY6 3ZOV 3VV7 4FRK 3OHF 3LHG 3L38 3I25 3EXO 3DV1 3DV5 2ZJL 2OHQ 1M4H 5ENK 2F3E 3K5C 4J0Z 5I3W 5I3Y 2OHN 3S7L 4J1K 3UDN 4J1H 4I0H 4I0I 3UQW 3U6A 3S7M 3NSH 3IXJ 3IVI 2ZJJ 2ZE1 2QK5 2OHK 2IS0 2HM1 3QBH 3IGB 3WB4 4J1F 3K5F 3IND 2OHP 2OHR 2OF0 1YM4 3HVG 4K9H 5IE1 4ZSQ 4LXM 4KE0 4BFD 4FRI 3RU1 3QI1 3IN4 3CKP 2ZJI 3BUF 3BUH 3BRA 2OHT 2F3F 2ZHT 2OHU 3L3A 4K8S 4BEK 4RCE 4D83 3PI5 3MSL 2ZHU 2Q11 2Q15 2OHS 5DQC 3RSX 3HW1 3WB5 3VV8 4FSL 4DUS 4DH6 3TPL 3RSV 3IXK 2WJO 2ZHR 3BUG 2VA6 2P83 2P4J 2HIZ 2FDP 3UDK 3R2F 4X2L 3TPR 1W51 3S2O 3KYR 3DM6 2ZJH 2QU2 5CLM 4IVS 4FSE 4D85 3RVI 2OHL 3RTH 3RTN 3N4L 3H0B 3CKR 2ZJN 2ZHS 2OHM 3UDQ 4TRY 2VA5 3RTM 3R1G 1XS7 4TRW 3SKG 3K5D 3SKF 2ZJK 3UQR 4TRZ 2VJ7 2VIJ 2VIE 2VA7
Thumbnails

Jmol
Position
11q23.2-q23.3
AA seq 501 aa AA seqDB search
MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
GLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGI
DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
ILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
RCLRCLRQQHDDFADDISLLK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagccctgccctggctcctgctgtggatgggcgcgggagtgctgcctgcccac
ggcacccagcacggcatccggctgcccctgcgcagcggcctggggggcgcccccctgggg
ctgcggctgccccgggagaccgacgaagagcccgaggagcccggccggaggggcagcttt
gtggagatggtggacaacctgaggggcaagtcggggcagggctactacgtggagatgacc
gtgggcagccccccgcagacgctcaacatcctggtggatacaggcagcagtaactttgca
gtgggtgctgccccccaccccttcctgcatcgctactaccagaggcagctgtccagcaca
taccgggacctccggaagggtgtgtatgtgccctacacccagggcaagtgggaaggggag
ctgggcaccgacctggtaagcatcccccatggccccaacgtcactgtgcgtgccaacatt
gctgccatcactgaatcagacaagttcttcatcaacggctccaactgggaaggcatcctg
gggctggcctatgctgagattgccaggcctgacgactccctggagcctttctttgactct
ctggtaaagcagacccacgttcccaacctcttctccctgcagctttgtggtgctggcttc
cccctcaaccagtctgaagtgctggcctctgtcggagggagcatgatcattggaggtatc
gaccactcgctgtacacaggcagtctctggtatacacccatccggcgggagtggtattat
gaggtgatcattgtgcgggtggagatcaatggacaggatctgaaaatggactgcaaggag
tacaactatgacaagagcattgtggacagtggcaccaccaaccttcgtttgcccaagaaa
gtgtttgaagctgcagtcaaatccatcaaggcagcctcctccacggagaagttccctgat
ggtttctggctaggagagcagctggtgtgctggcaagcaggcaccaccccttggaacatt
ttcccagtcatctcactctacctaatgggtgaggttaccaaccagtccttccgcatcacc
atccttccgcagcaatacctgcggccagtggaagatgtggccacgtcccaagacgactgt
tacaagtttgccatctcacagtcatccacgggcactgttatgggagctgttatcatggag
ggcttctacgttgtctttgatcgggcccgaaaacgaattggctttgctgtcagcgcttgc
catgtgcacgatgagttcaggacggcagcggtggaaggcccttttgtcaccttggacatg
gaagactgtggctacaacattccacagacagatgagtcaaccctcatgaccatagcctat
gtcatggctgccatctgcgccctcttcatgctgccactctgcctcatggtgtgtcagtgg
cgctgcctccgctgcctgcgccagcagcatgatgactttgctgatgacatctccctgctg
aagtga

DBGET integrated database retrieval system