KEGG   Homo sapiens (human): 23624Help
Entry
23624             CDS       T01001                                 

Gene name
CBLC, CBL-3, CBL-SL, RNF57
Definition
(RefSeq) Cbl proto-oncogene C
  KO
K22518  E3 ubiquitin-protein ligase CBL-C [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
Network
N00183  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23624 (CBLC)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    23624 (CBLC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     23624 (CBLC)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    23624 (CBLC)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    23624 (CBLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N3 Cbl_N Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX SH2 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 23624
NCBI-ProteinID: NP_036248
OMIM: 608453
HGNC: 15961
Ensembl: ENSG00000142273
Vega: OTTHUMG00000150715
Pharos: Q9ULV8(Tbio)
UniProt: Q9ULV8
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 474 aa AA seqDB search
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLE
GQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKD
VKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQE
GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcggtggccccgtgggggcgacagtgggaagaggcccgcgccctgggccgg
gcagtcaggatgctgcagcgcctagaagagcaatgcgtcgacccccggctgtccgtgagt
cccccttcgctgcgggacctgctgccccgcacagcgcagctgcttcgagaggtggcccat
tctcggcgggcggccggcggaggcggccccgggggtcccggcggctctggggactttcta
ctcatctacctggccaatctggaggccaagagcaggcaggtggccgcgctgctgcctccc
cggggccgaaggagtgccaacgacgagctcttccgggcgggctccagactcaggcgacag
ctggccaagctggccatcatcttcagccacatgcacgcagagctgcacgcactcttcccc
gggggaaagtactgtggacacatgtaccagctcaccaaggcccccgcccacaccttctgg
agggaaagttgcggagcccggtgtgtgctgccctgggctgagtttgagtccctcctgggc
acctgccaccctgtggaaccaggctgcacagccctggccttgcgcaccaccattgacctc
acctgcagcgggcacgtgtccatcttcgagttcgacgtcttcaccaggctctttcagcca
tggccaacactcctcaagaactggcagctcctggcagtcaaccacccaggctacatggcc
ttcctcacctatgatgaggtccaagagcgtctgcaggcctgcagggacaagccaggcagt
tacatcttccggcccagctgtactcgcctggggcagtgggccatcggctatgtgagctca
gatggcagcatcctgcagaccatccctgccaacaaacccctgtcccaggtgctcctggag
ggacagaaggacggcttctacctctacccagatggaaagacccacaacccagacctgact
gagctcggccaggcagaaccccagcagcgcatccacgtgtcagaggagcagctgcagctc
tactgggccatggactccacatttgagctctgcaagatctgtgctgagagcaacaaggat
gtgaagattgagccgtgcgggcacctgctctgcagctgctgcctggctgcctggcagcac
tcggacagccagacctgccccttctgccgctgcgagatcaagggctgggaggccgtgagt
atctaccagttccacggtcaggctactgctgaggactcagggaacagcagtgaccaggaa
ggcagggagttggagctggggcaggtgcccctttcggctcctccattgcccccacggcca
gatctgccccccaggaagcccagaaatgcccagccgaaagtgagactcctaaaggggaac
tcccctccagctgcgctgggaccccaggaccctgccccggcctga

DBGET integrated database retrieval system