KEGG   Homo sapiens (human): 23624Help
Entry
23624             CDS       T01001                                 

Gene name
CBLC, CBL-3, CBL-SL, RNF57
Definition
Cbl proto-oncogene C, E3 ubiquitin protein ligase
Orthology
K04707  
E3 ubiquitin-protein ligase CBL [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ubiquitin mediated proteolysis
Endocytosis
Jak-STAT signaling pathway
T cell receptor signaling pathway
Insulin signaling pathway
Bacterial invasion of epithelial cells
Pathways in cancer
Proteoglycans in cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23624 (CBLC)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    23624 (CBLC)
   04630 Jak-STAT signaling pathway
    23624 (CBLC)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    23624 (CBLC)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    23624 (CBLC)
  Endocrine system
   04910 Insulin signaling pathway
    23624 (CBLC)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23624 (CBLC)
   05205 Proteoglycans in cancer
    23624 (CBLC)
   05220 Chronic myeloid leukemia
    23624 (CBLC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    23624 (CBLC)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     23624 (CBLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 428 aa AA seqDB search
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDS
TFELCKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHG
QATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAAL
GPQDPAPA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcggtggccccgtgggggcgacagtgggaagaggcccgcgccctgggccgg
gcagtcaggatgctgcagcgcctagaagagcaatgcgtcgacccccggctgtccgtgagt
cccccttcgctgcgggacctgctgccccgcacagcgcagctgcttcgagaggtggcccat
tctcggcgggcggccggcggaggcggccccgggggtcccggcggctctggggactttcta
ctcatctacctggccaatctggaggccaagagcaggcaggtggccgcgctgctgcctccc
cggggccgaaggagtgccaacgacgagctcttccgggcgggctccagactcaggcgacag
ctggccaagctggccatcatcttcagccacatgcacgcagagctgcacgcactcttcccc
gggggaaagtactgtggacacatgtaccagctcaccaaggcccccgcccacaccttctgg
agggaaagttgcggagcccggtgtgtgctgccctgggctgagtttgagtccctcctgggc
acctgccaccctgtggaaccaggctgcacagccctggccttgcgcaccaccattgacctc
acctgcagcgggcacgtgtccatcttcgagttcgacgtcttcaccaggctctttcagcca
tggccaacactcctcaagaactggcagctcctggcagtcaaccacccaggctacatggcc
ttcctcacctatgatgaggtccaagagcgtctgcaggcctgcagggacaagccaggcagc
tacctctacccagatggaaagacccacaacccagacctgactgagctcggccaggcagaa
ccccagcagcgcatccacgtgtcagaggagcagctgcagctctactgggccatggactcc
acatttgagctctgcaagatctgtgctgagagcaacaaggatgtgaagattgagccgtgc
gggcacctgctctgcagctgctgcctggctgcctggcagcactcggacagccagacctgc
cccttctgccgctgcgagatcaagggctgggaggccgtgagtatctaccagttccacggt
caggctactgctgaggactcagggaacagcagtgaccaggaaggcagggagttggagctg
gggcaggtgcccctttcggctcctccattgcccccacggccagatctgccccccaggaag
cccagaaatgcccagccgaaagtgagactcctaaaggggaactcccctccagctgcgctg
ggaccccaggaccctgccccggcctga

DBGET integrated database retrieval system