KEGG   Homo sapiens (human): 23633Help
Entry
23633             CDS       T01001                                 

Gene name
KPNA6, IPOA7, KPNA7
Definition
(RefSeq) karyopherin subunit alpha 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O60684(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p35.2
AA seq 536 aa AA seqDB search
METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEA
AMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVI
NTPRVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDF
EDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRG
KNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLV
ELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTI
SNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSL
GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIE
FLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggagaccatggcgagcccagggaaagacaattatcgaatgaagagctataagaacaat
gctctaaaccctgaagaaatgagacgaagaagagaggaagagggcattcagctccggaag
cagaagcgagagcaacaactttttaaacggagaaatgtggagctgattaatgaagaagct
gccatgttcgatagtcttctcatggactcttatgtgagctctaccactggggagagtgtg
atcacaagagagatggtggagatgctcttttctgatgattctgacctgcagttagcaacc
acacagaaattccggaaactgctctccaaagagcctagtcctccaatagatgaagttatc
aacactccaagagtggtggatcggttcgtggagtttctgaagaggaatgagaattgtaca
ttacagtttgaagctgcctgggctctaacgaatattgcctctggaacctctcagcagacc
aaaattgtcattgaagcaggggctgtccccatttttatagagctgcttaattcagacttt
gaggatgttcaggaacaggcagtctgggcactgggaaacatagctggagatagctctgtt
tgccgagattacgtcttgaactgttccatccttaatcctttgttaacactccttaccaag
tccacacgactgacgatgacacggaatgcagtctgggccctgtcaaatctctgccgaggg
aaaaacccacccccagagtttgcaaaggtctctccttgtttgcctgtactgtctcgccta
ctcttcagcagcgactcggacttgctggcagatgcttgctgggccctttcttatctgtct
gatggccccaatgagaagatccaggcagtcatagactccggagtctgccggagattggta
gagctgctgatgcacaatgattacaaagtggcttctcctgccctgagagccgtgggtaac
atcgtcactggggatgacatccagacccaggtcattcttaactgttcagccctaccttgc
cttctccacttgttgagcagtcccaaggagtcaatccggaaggaagcttgctggactatt
tcaaatattactgctggcaacagggctcaaatacaggctgttatagatgcaaatatcttc
cctgtgttgatcgaaatccttcagaaagcagagtttcgtacaaggaaagaggcagcctgg
gccatcaccaatgccacatcaggaggaacccctgagcagatcaggtacctggtctcactg
ggctgcatcaaacccctatgtgacttgctgactgtaatggattcgaagattgtgcaagtg
gccctcaatggactggagaacatcctgcggcttggagagcaagagggcaagcgcagtggc
tcaggggtcaatccttattgtggcctcatagaggaagcctatggcttggataaaattgag
tttctccagagccacgagaaccaggagatctaccagaaggccttcgacctcattgagcac
tactttggtgtagaagacgatgatagcagcctggctccccaagtcgatgaaacgcaacag
cagttcatcttccagcagcctgaggcccccatggagggcttccagctataa

DBGET integrated database retrieval system