KEGG   Homo sapiens (human): 23636Help
Entry
23636             CDS       T01001                                 

Gene name
NUP62, IBSN, SNDI, p62
Definition
nucleoporin 62kDa
Orthology
K14306  
nuclear pore complex protein Nup62
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Disease
H01177  
Infantile bilateral striatal necrosis (IBSN)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    23636 (NUP62)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     23636 (NUP62)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 522 aa AA seqDB search
MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLF
SLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSN
LTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSA
QPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLC
TPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA
GIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA
WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGT
IYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNA
HMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggtttaattttggaggcactggggcccctacaggcgggttcacgtttggcact
gcaaagacggcaacaaccacacctgctacagggttttctttctccacctctggcactgga
gggtttaattttggggctcccttccaaccagccacaagtaccccttccaccggcctgttc
tcacttgccacccagactccggccacacagacgacaggcttcacttttggaacagcgact
cttgcttcggggggaactggattttctttggggatcggtgcttcaaagctcaacttgagc
aacacagctgccaccccagccatggcaaaccccagcggctttgggctgggcagcagcaac
ctcactaatgccatatcgagcaccgtcacctccagccagggcacagcacccaccggcttt
gtgtttggcccctccaccacctctgtggctccagctaccacatctggaggcttctcattc
actggtggaagcacggcccaaccctccggtttcaacattggctcagcagggaattcagcc
cagcccacggcacctgccacgttgcccttcactccggccacgccagcagccaccacagca
ggtgccacacagccagctgctcccacacccacagccaccatcaccagcactgggcccagc
ctctttgcgtcaatagcaactgctccaacctcatctgccaccactggactctccctctgt
acccctgtgaccacagcgggcgcccccactgctgggacacagggcttcagcttaaaggca
cctggagcagcttccggcacctccacaacaacatccaccgctgccaccgccaccgccacc
accaccagcagcagcagcaccaccggctttgccttgaatttaaaaccactggcgccagcc
gggatccccagcaatacagcagctgccgtgaccgctccacctggccctggcgcagctgca
ggggcggctgccagctccgccatgacctacgcgcagctggagagcctgatcaacaaatgg
agcctggagctagaggaccaggagcggcacttcctccagcaggccacccaggtcaacgcc
tgggaccgcacgctgatcgagaatggagaaaagatcaccagcctgcaccgcgaggtggag
aaggtgaagctggaccagaagaggctggaccaggagctcgacttcatcctgtcccagcag
aaggagctggaagacctgctgagcccactggaggagttggtcaaggagcagagcgggacc
atctacctgcagcacgcggatgaggagcgtgagaaaacctacaagctggctgagaacatc
gatgcacagctcaagcgcatggcccaggatctcaaggacatcatcgagcacctgaacacg
tccggggcccccgccgacaccagtgacccactgcagcagatctgcaagatcctcaatgcg
cacatggactcactgcagtggatcgaccagaactcggccctgctgcagaggaaggtggag
gaggtgaccaaggtgtgcgagggccggcgcaaggagcaggagcgcagcttccggatcacc
tttgactga

DBGET integrated database retrieval system