KEGG   Homo sapiens (human): 23637Help
Entry
23637             CDS       T01001                                 

Gene name
RABGAP1, GAPCENA, TBC1D11
Definition
(RefSeq) RAB GTPase activating protein 1
  KO
K20284  
Rab GTPase-activating protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.11
AA seq 1069 aa AA seqDB search
MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLKIVGNGSEQQL
QKELADVLMDPPMDDQPGEKELVKRSQLDGEGDGPLSNQLSASSTINPVPLVGLQKPEMS
LPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQI
SLDVTLSVPNVSEGIVRLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNA
ELFRIHVFRCEIQEAVSRILYSFATAFRRSAKQTPLSATAAPQTPDSDIFTFSVSLEIKE
DDGKGYFSAVPKDKDRQCFKLRQGIDKKIVIYVQQTTNKELAIERCFGLLLSPGKDVRNS
DMHLLDLESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKDKVLFMTTAVDLVITEVQE
PVRFLLETKVRVCSPNERLFWPFSKRSTTENFFLKLKQIKQRERKNNTDTLYEVVCLESE
SERERRKTTASPSVRLPQSGSQSSVIPSPPEDDEEEDNDEPLLSGSGDVSKECAEKILET
WGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKES
PQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLL
HMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEA
HMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGAL
KFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQAQQEDPIERFER
ENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEE
EKRRLEEESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIE
KIRQKVDDCERCREFFNKEGRVKGISSTKEVLDEDTDEEKETLKNQLREMELELAQTKLQ
LVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTATGVQGKETC
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaaggcttctgttggaaaaatcagtgtctcttcagactcagtatctactctt
aatagtgaagattttgtcttggtttccaggcaaggagatgagacaccatctacaaataat
ggaagtgatgatgagaaaacaggactcaagattgtagggaatggaagtgaacagcagctg
caaaaagagctagcagatgtactgatggatcctccaatggacgaccagccaggggaaaag
gagcttgtgaaaaggtcacaactggatggtgaaggagatgggcctctttctaatcagctc
tccgcttcatccaccattaaccctgtgccattagtagggctccaaaaaccagagatgagc
ctaccagtgaaacctggacaaggagattctgaagcttcaagtcctttcacaccagtggcc
gatgaggacagcgtagttttcagtaaactgacttacttaggctgtgcctcggtaaatgct
cccaggagtgaagtggaagccttaaggatgatgtccatcttaagaagccagtgtcagatt
tcactagatgttaccctttcagtgccgaatgtgtctgaaggaattgtgagactcttagat
cctcagacaaacactgaaatagcaaactaccctatctacaaaatcctcttctgtgtcaga
gggcatgatggaactcctgagagtgactgttttgctttcactgaaagtcattacaatgca
gagctcttcagaatacacgtcttccggtgtgaaatacaagaagctgtaagccggatactt
tacagttttgccactgccttccgccgttctgccaagcagaccccactttcagccactgct
gcaccccagactcctgacagtgacatctttaccttctctgtgtctttagaaataaaagaa
gatgatggtaaaggttattttagtgcagttcccaaagataaggacagacagtgctttaaa
ctacgccaaggaattgataagaagattgtcatctatgtgcagcaaacaactaataaagaa
cttgccattgaaaggtgttttggtcttctccttagtccaggaaaagatgtacgaaatagt
gacatgcacttattagatttggaatctatgggcaaaagttcagatggaaagtcgtatgtt
attacggggagctggaatccaaaatccccacattttcaagttgtaaatgaagaaactcct
aaagataaagtcctgtttatgaccacagctgtagatttggtaataacagaagtacaggag
cctgttcgatttctcctggagacaaaagtccgcgtttgctcacctaatgaaagattattc
tggcccttcagcaaacgtagtactactgaaaatttctttttgaaactaaaacagataaag
caaagggagagaaagaataatactgacactttatatgaagttgtatgcttggaaagtgaa
tcagaaagagagaggaggaaaactacagccagtccttcagttcgcctgccacagtctgga
tcgcaaagttcagtgataccttctcctccagaagatgatgaagaggaagataatgatgaa
cctctcctgagtggatctggtgatgtatccaaagaatgtgcagaaaaaattcttgaaaca
tggggagaactgttgtcaaaatggcatctcaacttgaatgtgagaccgaagcagttgtca
tccttagtaagaaacggtgtccctgaagctcttcgaggagaagtctggcagctgctagca
ggctgtcataacaatgaccacctggtagagaaataccgcattcttatcacaaaggagtct
ccccaggacagtgctatcacccgggatattaaccgaacattcccagcccatgactacttt
aaggacacaggaggagatggacaagattccttatataaaatatgcaaggcttattctgtg
tatgatgaagagattggttattgccagggccagtcatttcttgctgctgtgctccttctc
catatgcctgaagaacaggcattcagtgttctggtcaagatcatgtttgactatgggctc
agggaacttttcaagcaaaacttcgaagatttgcattgcaaattttaccagttggagcgc
ctcatgcaggaatacattcctgacctgtacaaccacttcctggatataagccttgaagca
cacatgtatgcctcccagtggtttcttactcttttcactgcaaaattccctctctacatg
gtcttccatatcatcgacctgcttttatgtgagggaataagtgttatttttaatgtcgcc
cttggattattaaagacttcgaaagatgacctgctgttgacagactttgaaggtgccttg
aagttctttagggttcagcttcctaagagataccgctcagaagaaaatgcaaaaaaacta
atggaattagcctgcaacatgaagattagtcagaagaagttgaaaaaatacgagaaagaa
tatcacaccatgagggaacagcaggcccagcaagaagaccccatcgagcgatttgagcgg
gagaataggcgtctacaagaagctaacatgaggttggaacaggaaaacgatgacttagcc
catgagctggtgaccagcaagattgcactacggaaggacctggataacgctgaggaaaag
gcagatgctctgaataaggagctgctgatgaccaaacagaagttgattgatgcagaagaa
gagaaaagacggctggaagaagagtctgctcagttaaaagaaatgtgccgtcgggaactc
gacaaggcagaatctgagattaaaaaaaacagttctatcattggtgactataagcagatt
tgttctcagttgagtgaaagattggagaagcagcagacagccaataaggtggaaattgag
aaaattcggcaaaaagtggatgactgtgagcggtgccgggaatttttcaacaaagaaggg
cgtgtaaaaggcataagctcaaccaaggaggttttagatgaggacacggatgaagagaaa
gagacgctcaagaaccagctgagagaaatggagctagaactggcacagaccaaactccag
ctggtggaggccgagtgtaagatacaggacttggaacaccatttagggcttgccctcaat
gaggtgcaggcagccaagaagacgtggtttaaccgaacactgagctccataaagacagca
accggggttcaagggaaagagacttgctga

DBGET integrated database retrieval system