KEGG   Homo sapiens (human): 23643Help
Entry
23643             CDS       T01001                                 

Gene name
LY96, ESOP-1, MD-2, MD2, ly-96
Definition
(RefSeq) lymphocyte antigen 96
  KO
K05400  lymphocyte antigen 96
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05133  Pertussis
hsa05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    23643 (LY96)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    23643 (LY96)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    23643 (LY96)
   05133 Pertussis
    23643 (LY96)
   05145 Toxoplasmosis
    23643 (LY96)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_DerP2_DerF2
Motif
Other DBs
NCBI-GeneID: 23643
NCBI-ProteinID: NP_056179
OMIM: 605243
HGNC: 17156
Ensembl: ENSG00000154589
Vega: OTTHUMG00000164504
Pharos: Q9Y6Y9(Tbio)
UniProt: Q9Y6Y9
Structure
PDB: 

Jmol
Position
8q21.11
AA seq 160 aa AA seqDB search
MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGL
LHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFS
FKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgttaccatttctgtttttttccaccctgttttcttccatatttactgaagctcagaag
cagtattgggtctgcaactcatccgatgcaagtatttcatacacctactgtgataaaatg
caatacccaatttcaattaatgttaacccctgtatagaattgaaaggatccaaaggatta
ttgcacattttctacattccaaggagagatttaaagcaattatatttcaatctctatata
actgtcaacaccatgaatcttccaaagcgcaaagaagttatttgccgaggatctgatgac
gattactctttttgcagagctctgaagggagagactgtgaatacaacaatatcattctcc
ttcaagggaataaaattttctaagggaaaatacaaatgtgttgttgaagctatttctggg
agcccagaagaaatgctcttttgcttggagtttgtcatcctacaccaacctaattcaaat
tag

DBGET integrated database retrieval system