KEGG   Homo sapiens (human): 23643Help
Entry
23643             CDS       T01001                                 

Gene name
LY96, ESOP-1, MD-2, MD2, ly-96
Definition
(RefSeq) lymphocyte antigen 96
  KO
K05400  
lymphocyte antigen 96
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Pathogenic Escherichia coli infection
Pertussis
Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    23643 (LY96)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    23643 (LY96)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    23643 (LY96)
   05133 Pertussis
    23643 (LY96)
   05145 Toxoplasmosis
    23643 (LY96)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21.11
AA seq 160 aa AA seqDB search
MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGL
LHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFS
FKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgttaccatttctgtttttttccaccctgttttcttccatatttactgaagctcagaag
cagtattgggtctgcaactcatccgatgcaagtatttcatacacctactgtgataaaatg
caatacccaatttcaattaatgttaacccctgtatagaattgaaaggatccaaaggatta
ttgcacattttctacattccaaggagagatttaaagcaattatatttcaatctctatata
actgtcaacaccatgaatcttccaaagcgcaaagaagttatttgccgaggatctgatgac
gattactctttttgcagagctctgaagggagagactgtgaatacaacaatatcattctcc
ttcaagggaataaaattttctaagggaaaatacaaatgtgttgttgaagctatttctggg
agcccagaagaaatgctcttttgcttggagtttgtcatcctacaccaacctaattcaaat
tag

DBGET integrated database retrieval system