KEGG   Homo sapiens (human): 23658Help
Entry
23658             CDS       T01001                                 

Gene name
LSM5, YER146W
Definition
(RefSeq) LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12624  U6 snRNA-associated Sm-like protein LSm5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Module
hsa_M00354  Spliceosome, U4/U6.U5 tri-snRNP
hsa_M00396  Lsm 2-8 complex
hsa_M00397  Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    23658 (LSM5)
  Folding, sorting and degradation
   03018 RNA degradation
    23658 (LSM5)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     23658 (LSM5)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     23658 (LSM5)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    23658 (LSM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSM SM-ATX
Motif
Other DBs
NCBI-GeneID: 23658
NCBI-ProteinID: NP_036454
OMIM: 607285
HGNC: 17162
Ensembl: ENSG00000106355
Vega: OTTHUMG00000022913
Pharos: Q9Y4Y9(Tdark)
UniProt: Q9Y4Y9 A0A090N8Y5
Structure
PDB: 

Jmol
Position
7p14.3
AA seq 91 aa AA seqDB search
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEIT
PEGRRITKLDQILLNGNNITMLVPGGEGPEV
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggcggctaacgctactaccaacccgtcgcagctgctgcccttagagcttgtggacaaa
tgtataggatcaagaattcacatcgtgatgaagagtgataaggaaattgttggtactctt
ctaggatttgatgactttgtcaatatggtactggaagatgtcactgagtttgaaatcaca
ccagaaggaagaaggattactaaattagatcagattttgctaaatggaaataatataaca
atgctggttcctggaggagaaggacctgaagtgtga

DBGET integrated database retrieval system