KEGG   Homo sapiens (human): 23658Help
Entry
23658             CDS       T01001                                 

Gene name
LSM5, YER146W
Definition
(RefSeq) LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12624  
U6 snRNA-associated Sm-like protein LSm5
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    23658 (LSM5)
  Folding, sorting and degradation
   03018 RNA degradation
    23658 (LSM5)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     23658 (LSM5)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     23658 (LSM5)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    23658 (LSM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p14.3
AA seq 91 aa AA seqDB search
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEIT
PEGRRITKLDQILLNGNNITMLVPGGEGPEV
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggcggctaacgctactaccaacccgtcgcagctgctgcccttagagcttgtggacaaa
tgtataggatcaagaattcacatcgtgatgaagagtgataaggaaattgttggtactctt
ctaggatttgatgactttgtcaatatggtactggaagatgtcactgagtttgaaatcaca
ccagaaggaagaaggattactaaattagatcagattttgctaaatggaaataatataaca
atgctggttcctggaggagaaggacctgaagtgtga

DBGET integrated database retrieval system