KEGG   Homo sapiens (human): 23659Help
Entry
23659             CDS       T01001                                 

Gene name
PLA2G15, ACS, GXVPLA2, LLPL, LPLA2, LYPLA3
Definition
phospholipase A2, group XV (EC:2.3.1.-)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    23659 (PLA2G15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    23659 (PLA2G15)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     23659 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 412 aa AA seqDB search
MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTV
VHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGK
TFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREM
IEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQ
DIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGD
GTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggcctccacctccgcccctaccgtgtggggctgctcccggatggcctcctgttcctc
ttgctgctgctaatgctgctcgcggacccagcgctcccggccggacgtcaccccccagtg
gtgctggtccctggtgatttgggtaaccaactggaagccaagctggacaagccgacagtg
gtgcactacctctgctccaagaagaccgaaagctacttcacaatctggctgaacctggaa
ctgctgctgcctgtcatcattgactgctggattgacaatatcaggctggtttacaacaaa
acatccagggccacccagtttcctgatggtgtggatgtacgtgtccctggctttgggaag
accttctcactggagttcctggaccccagcaaaagcagcgtgggttcctatttccacacc
atggtggagagccttgtgggctggggctacacacggggtgaggatgtccgaggggctccc
tatgactggcgccgagccccaaatgaaaacgggccctacttcctggccctccgcgagatg
atcgaggagatgtaccagctgtatgggggccccgtggtgctggttgcccacagtatgggc
aacatgtacacgctctactttctgcagcggcagccgcaggcctggaaggacaagtatatc
cgggccttcgtgtcactgggtgcgccctgggggggcgtggccaagaccctgcgcgtcctg
gcttcaggagacaacaaccggatcccagtcatcgggcccctgaagatccgggagcagcag
cggtcagctgtctccaccagctggctgctgccctacaactacacatggtcacctgagaag
gtgttcgtgcagacacccacaatcaactacacactgcgggactaccgcaagttcttccag
gacatcggctttgaagatggctggctcatgcggcaggacacagaagggctggtggaagcc
acgatgccacctggcgtgcagctgcactgcctctatggtactggcgtccccacaccagac
tccttctactatgagagcttccctgaccgtgaccctaaaatctgctttggtgacggcgat
ggtactgtgaacttgaagagtgccctgcagtgccaggcctggcagagccgccaggagcac
caagtgttgctgcaggagctgccaggcagcgagcacatcgagatgctggccaacgccacc
accctggcctatctgaaacgtgtgctccttgggccctga

DBGET integrated database retrieval system