KEGG   Homo sapiens (human): 23671Help
Entry
23671             CDS       T01001                                 

Gene name
TMEFF2, CT120.2, HPP1, TENB2, TPEF, TR
Definition
transmembrane protein with EGF-like and two follistatin-like domains 2
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q32.3
AA seq 374 aa AA seqDB search
MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAA
CKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDG
HYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgtgggagtccccgcggcagtgcagcagctggacactttgcgagggcttttgc
tggctgctgctgctgcccgtcatgctactcatcgtagcccgcccggtgaagctcgctgct
ttccctacctccttaagtgactgccaaacgcccaccggctggaattgctctggttatgat
gacagagaaaatgatctcttcctctgtgacaccaacacctgtaaatttgatggggaatgt
ttaagaattggagacactgtgacttgcgtctgtcagttcaagtgcaacaatgactatgtg
cctgtgtgtggctccaatggggagagctaccagaatgagtgttacctgcgacaggctgca
tgcaaacagcagagtgagatacttgtggtgtcagaaggatcatgtgccacagatgcagga
tcaggatctggagatggagtccatgaaggctctggagaaactagtcaaaaggagacatcc
acctgtgatatttgccagtttggtgcagaatgtgacgaagatgccgaggatgtctggtgt
gtgtgtaatattgactgttctcaaaccaacttcaatcccctctgcgcttctgatgggaaa
tcttatgataatgcatgccaaatcaaagaagcatcgtgtcagaaacaggagaaaattgaa
gtcatgtctttgggtcgatgtcaagataacacaactacaactactaagtctgaagatggg
cattatgcaagaacagattatgcagagaatgctaacaaattagaagaaagtgccagagaa
caccacataccttgtccggaacattacaatggcttctgcatgcatgggaagtgtgagcat
tctatcaatatgcaggagccatcttgcaggtgtgatgctggttatactggacaacactgt
gaaaaaaaggactacagtgttctatacgttgttcccggtcctgtacgatttcagtatgtc
ttaatcgcagctgtgattggaacaattcagattgctgtcatctgtgtggtggtcctctgc
atcacaaggaaatgccccagaagcaacagaattcacagacagaagcaaaatacagggcac
tacagttcagacaatacaacaagagcgtccacgaggttaatctaa

DBGET integrated database retrieval system