KEGG   Homo sapiens (human): 23671Help
Entry
23671             CDS       T01001                                 

Gene name
TMEFF2, CT120.2, HPP1, TENB2, TPEF, TR, TR-2
Definition
(RefSeq) transmembrane protein with EGF like and two follistatin like domains 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Kazal_2 Kazal_1 EGF_2 EGF EphA2_TM
Motif
Other DBs
NCBI-GeneID: 23671
NCBI-ProteinID: NP_057276
OMIM: 605734
HGNC: 11867
Ensembl: ENSG00000144339
Vega: OTTHUMG00000132723
Pharos: Q9UIK5(Tbio)
UniProt: Q9UIK5
Position
2q32.3
AA seq 374 aa AA seqDB search
MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAA
CKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDG
HYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgtgggagtccccgcggcagtgcagcagctggacactttgcgagggcttttgc
tggctgctgctgctgcccgtcatgctactcatcgtagcccgcccggtgaagctcgctgct
ttccctacctccttaagtgactgccaaacgcccaccggctggaattgctctggttatgat
gacagagaaaatgatctcttcctctgtgacaccaacacctgtaaatttgatggggaatgt
ttaagaattggagacactgtgacttgcgtctgtcagttcaagtgcaacaatgactatgtg
cctgtgtgtggctccaatggggagagctaccagaatgagtgttacctgcgacaggctgca
tgcaaacagcagagtgagatacttgtggtgtcagaaggatcatgtgccacagatgcagga
tcaggatctggagatggagtccatgaaggctctggagaaactagtcaaaaggagacatcc
acctgtgatatttgccagtttggtgcagaatgtgacgaagatgccgaggatgtctggtgt
gtgtgtaatattgactgttctcaaaccaacttcaatcccctctgcgcttctgatgggaaa
tcttatgataatgcatgccaaatcaaagaagcatcgtgtcagaaacaggagaaaattgaa
gtcatgtctttgggtcgatgtcaagataacacaactacaactactaagtctgaagatggg
cattatgcaagaacagattatgcagagaatgctaacaaattagaagaaagtgccagagaa
caccacataccttgtccggaacattacaatggcttctgcatgcatgggaagtgtgagcat
tctatcaatatgcaggagccatcttgcaggtgtgatgctggttatactggacaacactgt
gaaaaaaaggactacagtgttctatacgttgttcccggtcctgtacgatttcagtatgtc
ttaatcgcagctgtgattggaacaattcagattgctgtcatctgtgtggtggtcctctgc
atcacaaggaaatgccccagaagcaacagaattcacagacagaagcaaaatacagggcac
tacagttcagacaatacaacaagagcgtccacgaggttaatctaa

DBGET integrated database retrieval system