KEGG   Homo sapiens (human): 23678Help
Entry
23678             CDS       T01001                                 

Gene name
SGK3, CISK, SGK2, SGKL
Definition
(RefSeq) serum/glucocorticoid regulated kinase family member 3
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    23678 (SGK3)
   04151 PI3K-Akt signaling pathway
    23678 (SGK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23678 (SGK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   23678 (SGK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PX Pkinase_C Kinase-like FTA2 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 23678
NCBI-ProteinID: NP_001028750
OMIM: 607591
HGNC: 10812
Ensembl: ENSG00000104205
Vega: OTTHUMG00000164561
Pharos: Q96BR1(Tbio)
UniProt: Q96BR1 Q5H9Q5 A0A024R807
Position
8q13.1
AA seq 496 aa AA seqDB search
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNT
LKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMD
SPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAK
RKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVL
DFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHV
VLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPP
FYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADD
AFVGFSYAPPSEDLFL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagagatcacaccatggactacaaggaaagctgcccaagtgtaagcattcccagc
tccgatgaacacagagagaaaaagaagaggtttactgtttataaagttctggtttcagtg
ggaagaagtgaatggtttgtcttcaggagatatgcagagtttgataaactttataacact
ttaaaaaaacagtttcctgctatggccctgaagattcctgccaagagaatatttggtgat
aattttgatccagattttattaaacaaagacgagcaggactaaacgaattcattcagaac
ctagttaggtatccagaactttataaccatccagatgtcagagcattccttcaaatggac
agtccaaaacaccagtcagatccatctgaagatgaggatgaaagaagttctcagaagcta
cactctacctcacagaacatcaacctgggaccgtctggaaatcctcatgccaaaccaact
gactttgatttcttaaaagttattggaaaaggcagctttggcaaggttcttcttgcaaaa
cggaaactggatggaaaattttatgctgtcaaagtgttacagaaaaaaatagttctcaac
agaaaagagcaaaaacatattatggctgaacgtaatgtgctcttgaaaaatgtgaaacat
ccgtttttggttggattgcattattccttccaaacaactgaaaagctttattttgttctg
gattttgttaatggaggggagctttttttccacttacaaagagaacggtcctttcctgag
cacagagctaggttttacgctgctgaaattgctagtgcattgggttacttacattccatc
aaaatagtatacagagacttgaaaccagaaaatattcttttggattcagtaggacatgtt
gtcttaacagattttgggctttgtaaagaaggaattgctatttctgacaccactaccaca
ttttgtgggacaccagagtatcttgcacctgaagtaattagaaaacagccctatgacaat
actgtagattggtggtgccttggggctgttctgtatgaaatgctgtatggattgcctcct
ttttattgccgagatgttgctgaaatgtatgacaatatccttcacaaacccctaagtttg
aggccaggagtgagtcttacagcctggtccattctggaagaactcctagaaaaagacagg
caaaatcgacttggtgccaaggaagactttcttgaaattcagaatcatcctttttttgaa
tcactcagctgggctgaccttgtacaaaagaagattccaccaccatttaatcctaatgtg
gctggaccagatgatatcagaaactttgacacagcatttacagaagaaacagttccatat
tctgtgtgtgtatcttctgactattctatagtgaatgccagtgtattggaggcagatgat
gcattcgttggtttctcttatgcacctccttcagaagacttatttttgtga

DBGET integrated database retrieval system