KEGG   Homo sapiens (human): 23705Help
Entry
23705             CDS       T01001                                 

Gene name
CADM1, BL2, IGSF4, IGSF4A, NECL2, Necl-2, RA175, ST17, SYNCAM, TSLC1, sTSLC-1, sgIGSF, synCAM1
Definition
cell adhesion molecule 1
Orthology
K06781  
cell adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Disease
H00054  
Nasopharyngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    23705 (CADM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.2
AA seq 414 aa AA seqDB search
MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVA
TISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEG
RYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWF
KGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQ
YKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFI
NNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSRAGEEGSIRAVDHAVIGGVVAVVVFAM
LCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgtagtgctgccgagcggatcccagtgtgcggcggcagcggcggcggcggcg
cctcccgggctccggctccggcttctgctgttgctcttctccgccgcggcactgatcccc
acaggtgatgggcagaatctgtttacgaaagacgtgacagtgatcgagggagaggttgcg
accatcagttgccaagtcaataagagtgacgactctgtgattcagctactgaatcccaac
aggcagaccatttatttcagggacttcaggcctttgaaggacagcaggtttcagttgctg
aatttttctagcagtgaactcaaagtatcattgacaaacgtctcaatttctgatgaagga
agatacttttgccagctctataccgatcccccacaggaaagttacaccaccatcacagtc
ctggtcccaccacgtaatctgatgatcgatatccagaaagacactgcggtggaaggtgag
gagattgaagtcaactgcactgctatggccagcaagccagccacgactatcaggtggttc
aaagggaacacagagctaaaaggcaaatcggaggtggaagagtggtcagacatgtacact
gtgaccagtcagctgatgctgaaggtgcacaaggaggacgatggggtcccagtgatctgc
caggtggagcaccctgcggtcactggaaacctgcagacccagcggtatctagaagtacag
tataagcctcaagtgcacattcagatgacttatcctctacaaggcttaacccgggaaggg
gacgcgcttgagttaacatgtgaagccatcgggaagccccagcctgtgatggtaacttgg
gtgagagtcgatgatgaaatgcctcaacacgccgtactgtctgggcccaacctgttcatc
aataacctaaacaaaacagataatggtacataccgctgtgaagcttcaaacatagtgggg
aaagctcactcggattatatgctgtatgtatacgattcccgagcaggtgaagaaggctcg
atcagggcagtggatcatgccgtgatcggtggcgtcgtggcggtggtggtgttcgccatg
ctgtgcttgctcatcattctggggcgctattttgccagacataaaggtacatacttcact
catgaagccaaaggagccgatgacgcagcagacgcagacacagctataatcaatgcagaa
ggaggacagaacaactccgaagaaaagaaagagtacttcatctag

DBGET integrated database retrieval system