KEGG   Homo sapiens (human): 23753Help
Entry
23753             CDS       T01001                                 

Gene name
SDF2L1
Definition
stromal cell-derived factor 2-like 1
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 221 aa AA seqDB search
MWSAGRGGAAWPVLLGLLLALLVPGGGAAKTGAELVTCGSVLKLLNTHHRVRLHSHDIKY
GSGSGQQSVTGVEASDDANSYWRIRGGSEGGCPRGSPVRCGQAVRLTHVLTGKNLHTHHF
PSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREAAVRFQHVGTSVFLSVTGEQYGS
PIRGQHEVHGMPSANTHNTWKAMEGIFIKPSVEPSAGHDEL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtggagcgcgggccgcggcggggctgcctggccggtgctgttggggctgctgctggcg
ctgttagtgccgggcggtggtgccgccaagaccggtgcggagctcgtgacctgcgggtcg
gtgctgaagctgctcaatacgcaccaccgcgtgcggctgcactcgcacgacatcaaatac
ggatccggcagcggccagcaatcggtgaccggcgtagaggcgtcggacgacgccaatagc
tactggcggatccgcggcggctcggagggcgggtgcccgcgcgggtccccggtgcgctgc
gggcaggcggtgaggctcacgcatgtgcttacgggcaagaacctgcacacgcaccacttc
ccgtcgccgctgtccaacaaccaggaggtgagtgcctttggggaagacggcgagggcgac
gacctggacctatggacagtgcgctgctctggacagcactgggagcgtgaggctgctgtg
cgcttccagcatgtgggcacctctgtgttcctgtcagtcacgggtgagcagtatggaagc
cccatccgtgggcagcatgaggtccacggcatgcccagtgccaacacgcacaatacgtgg
aaggccatggaaggcatcttcatcaagcctagtgtggagccctctgcaggtcacgatgaa
ctctga

DBGET integrated database retrieval system