KEGG   Homo sapiens (human): 239Help
Entry
239               CDS       T01001                                 

Gene name
ALOX12, 12-LOX, 12S-LOX, LOG12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S type
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    239 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    239 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    239 (ALOX12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    239 (ALOX12)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     239 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P18054(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 663 aa AA seqDB search
MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLL
QFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNA
LDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKA
GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPML
LRRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYH
LLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVH
LFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR
QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENS
VTI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctaccgcatccgcgtggccaccggggcctggctcttctccgggtcgtacaac
cgcgtgcagctttggctggtcgggacgcgcggggaggcggagctggagctgcagctgcgg
cccgcgcggggcgaggaggaggagtttgatcatgacgttgcagaggacttggggctcctg
cagttcgtgaggctgcgcaagcaccactggctggtggacgacgcgtggttctgcgaccgc
atcacggtgcagggccctggagcctgcgcggaggtggccttcccgtgctaccgctgggtg
cagggcgaggacatcctgagcctgcccgagggcaccgcccgcctgccaggagacaatgct
ttggacatgttccagaagcatcgagagaaggaactgaaagacagacagcagatctactgc
tgggccacctggaaggaagggttacccctgaccatcgctgcagaccgtaaggatgatcta
cctccaaatatgagattccatgaggagaagaggctggactttgaatggacactgaaggca
ggggctctggagatggccctcaaacgtgtttacaccctcctgagctcctggaactgccta
gaagactttgatcagatcttctggggccagaagagtgccctggctgagaaggttcgccag
tgctggcaggatgatgagttgttcagctaccagttcctcaatggtgccaaccccatgctg
ttgagacgctcgacctctctgccctccaggctagtgctgccctcggggatggaagagctt
caggctcaactggagaaagaacttcagaatggttccctgtttgaagctgacttcatcctt
ctggatggaattccagccaacgtgatccgaggagagaagcaatacctggctgcccccctc
gttatgctgaagatggagcccaatgggaagctgcagcccatggtcatccagattcagcct
cccaaccccagctctccaaccccaacactgttcctgccctcagaccccccacttgcctgg
ctcctggcaaagtcctgggtccgaaattcagatttccaactgcacgagatccagtatcac
ttgctgaacactcacctggtggctgaggtcatcgctgtcgccaccatgcggtgcctccca
ggactgcaccccatcttcaagttcctgatcccccatatccgctacaccatggaaatcaac
acccgggcccggacccaactcatctcagatggaggaatttttgataaggcagtgagcaca
ggtggagggggccatgtacagttgctccgtcgggcggcagctcagctgacctactgctcc
ctctgtcctcctgacgacctggctgaccggggcctgctgggactcccaggtgctctctat
gcccatgatgctttacggctctgggagatcattgccaggtatgtggaggggatcgtccac
ctcttctaccaaagggatgacatagtgaagggggaccctgagctgcaggcctggtgtcgg
gagatcacggaggtggggctgtgccaggcccaggaccgaggtttccctgtctccttccag
tcccagagtcaactctgccatttcctcaccatgtgcgtcttcacgtgcactgcccagcat
gccgccatcaaccagggccagctggactggtatgcctgggtccctaatgctccatgcaca
atgcggatgcccccacccaccaccaaggaagatgtgacgatggccacagtgatggggtca
ctacctgatgtccggcaggcctgtcttcaaatggccatctcatggcatctgagtcgccgc
cagccagacatggtgcctctggggcaccacaaagaaaaatatttctcaggccccaagccc
aaagctgtgctaaaccaattccgaacagatttggaaaagctggaaaaggagattacagcc
cggaatgagcaacttgactggccctatgaatatctgaagcccagctgcatagagaacagt
gtcaccatctga

DBGET integrated database retrieval system