KEGG   Homo sapiens (human): 2395Help
Entry
2395              CDS       T01001                                 

Gene name
FXN, CyaY, FA, FARR, FRDA, X25
Definition
(RefSeq) frataxin (EC:1.16.3.1)
  KO
K19054  
frataxin [EC:1.16.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
Disease
H00067  
Friedreich ataxia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    2395 (FXN)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.1  ferroxidase
     2395 (FXN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q21.11
AA seq 210 aa AA seqDB search
MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQR
GLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTF
EDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV
SLHELLAAELTKALKTKLDLSSLAYSGKDA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtggactctcgggcgccgcgcagtagccggcctcctggcgtcacccagcccagcccag
gcccagaccctcacccgggtcccgcggccggcagagttggccccactctgcggccgccgt
ggcctgcgcaccgacatcgatgcgacctgcacgccccgccgcgcaagttcgaaccaacgt
ggcctcaaccagatttggaatgtcaaaaagcagagtgtctatttgatgaatttgaggaaa
tctggaactttgggccacccaggctctctagatgagaccacctatgaaagactagcagag
gaaacgctggactctttagcagagttttttgaagaccttgcagacaagccatacacgttt
gaggactatgatgtctcctttgggagtggtgtcttaactgtcaaactgggtggagatcta
ggaacctatgtgatcaacaagcagacgccaaacaagcaaatctggctatcttctccatcc
agtggacctaagcgttatgactggactgggaaaaactgggtgtactcccacgacggcgtg
tccctccatgagctgctggccgcagagctcactaaagccttaaaaaccaaactggacttg
tcttccttggcctattccggaaaagatgcttga

DBGET integrated database retrieval system