KEGG   Homo sapiens (human): 24140Help
Entry
24140             CDS       T01001                                 

Gene name
FTSJ1, CDLIV, MRX44, MRX9, SPB1, TRMT7
Definition
FtsJ RNA methyltransferase homolog 1 (E. coli) (EC:2.1.1.205)
Orthology
K14864  
tRNA (cytidine32/guanosine34-2'-O)-methyltransferase [EC:2.1.1.205]
Organism
hsa  Homo sapiens (human)
Disease
H00480  
Non-syndromic X-linked mental retardation
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.205  tRNA (cytidine32/guanosine34-2'-O)-methyltransferase
     24140 (FTSJ1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    24140 (FTSJ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.23
AA seq 192 aa AA seqDB search
MALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQ
GYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGG
SEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLA
PEMEDNEMSCSP
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaacattgctacacatgtcctgaagccagggggctgctttgtggccaagata
ttccgaggccgggatgtgacgctcctctacagccagctgcaggtcttcttctccagcgtg
ctgtgtgccaagcccaggagcagccggaactctagcatcgaggccttcgctgtctgtcag
ggctatgaccctcccgagggcttcatcccggacctgagcaaacccctgctggaccattct
tacgacccagatttcaaccagctggatggtcccacccgcatcattgtgccttttgtgacc
tgtggggacctgagctcctatgattcggaccgcagttacccactggacctagagggcggc
tcagagtacaagtacactccacccacacagccccccatctcgccaccataccaggaggcc
tgcacgttgaagaggaaggggcagctggccaaggagatccgcccccaggactgccccatc
agcagagtggacacgtttccccagcccctggccgcccctcagtgccacaccctgctggcc
cctgagatggaagacaatgaaatgagttgttcaccttaa

DBGET integrated database retrieval system