KEGG   Homo sapiens (human): 242Help
Entry
242               CDS       T01001                                 

Gene name
ALOX12B, 12R-LOX, ARCI2
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12R type
  KO
K08021  arachidonate 12-lipoxygenase (R-type) [EC:1.13.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
Disease
H00734  Autosomal recessive congenital ichthyosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    242 (ALOX12B)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    242 (ALOX12B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     242 (ALOX12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 242
NCBI-ProteinID: NP_001130
OMIM: 603741
HGNC: 430
Ensembl: ENSG00000179477
Vega: OTTHUMG00000108180
Pharos: O75342(Tbio)
UniProt: O75342
Position
17p13.1
AA seq 701 aa AA seqDB search
MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQD
LGELIIIRLHKERYAFFPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALREATGKT
TADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPNRPEWNGY
IPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIR
KIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDDMVAPFLGE
GTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGKMMPIAIQLSQ
TPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMC
HPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLY
LPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDAAVEGDPELQSWVQEI
FKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNTGQMEFTAWMPNFPASMR
NPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPLGHFPDIHFVEEAPRR
SIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggccacctacaaagtcagggtggccacaggcaccgacctcttgtcgggaacacgggac
tccatctcactgaccattgtggggacacaaggagagagccataagcagctgctgaaccac
tttgggagagactttgcaactggggcggtgggccagtacaccgtgcagtgccctcaggac
ctgggtgagctcatcatcatccgcctgcacaaagagcggtacgccttcttccccaaggac
ccttggtactgcaactatgtgcagatctgtgcccccaacggccgtatctaccacttcccc
gcctaccagtggatggatggctacgagaccctggcactccgggaggccacaggaaagaca
acagcagatgactcgctccccgtcctcctggagcacagaaaagaggagatcagagccaag
caggacttctaccactggcgagtctttcttcctggcctgcccagctatgtgcacattccc
agttaccgccctccggtgcggaggcatcgcaaccccaaccggcctgagtggaatggctat
attccgggattcccaattctcatcaactttaaggccaccaagttcctgaacttaaatctc
cgctactccttcctcaagacggcctccttcttcgtccgcctggggcccatggcactggct
ttcaaagtccgcggcctgttggactgcaaacattcgtggaagaggctgaaggacattagg
aaaattttccctggcaagaaatctgtcgtctccgagtacgtggccgagcactgggcagag
gacaccttctttgggtaccagtacctcaacggcgtcaaccccggcctgatccgccgctgc
acgcggatcccagacaagttccccgtcacagacgacatggtggctccgttcctgggcgag
ggaacgtgcttgcaagcggagctggagaaggggaacatttacctggccgactaccgcatc
atggagggcatccccaccgtggagctcagcggccggaagcagcaccactgcgcccccctc
tgcctgctgcactttggacccgagggcaagatgatgcccatcgccatccagctcagccag
acccctgggccagattgccccatcttcctgcccagtgattctgagtgggactggctgcta
gccaagacgtgggtacgctatgcggagttctacagccacgaggccatcgcccacctgctg
gagacacacctcattgctgaggccttctgcctggccttgctgaggaacctgcccatgtgc
caccccctctacaagctcctcatcccccatacccgatacaccgtccagatcaacagcatt
ggccgggccgttctcctcaatgagggggggctctctgccaagggcatgtccctgggcgtg
gaaggctttgctggggtgatggtacgggctctgtcggagctcacctatgacagcctctac
ctccccaatgactttgtggagcgtggggtccaggacctgcctggatattactaccgcgat
gacagcttggcggtgtggaatgcactggagaagtatgtgacggagatcatcacctattat
tacccgagtgacgcagccgtggagggtgatccggaattgcagtcttgggtgcaggaaata
tttaaagagtgcctcctggggcgggagagctcaggcttccctaggtgcttgcgaaccgtg
cctgagctgatccgatatgtcactatagtcatctacacctgctctgccaagcacgctgct
gtcaacacaggccagatggagttcaccgcctggatgcccaacttcccagcgtccatgcgg
aatccaccgattcagactaaggggctgaccactctggagaccttcatggacacgttgccg
gatgtgaagaccacgtgcatcacgctgctggtgctctggaccctcagccgagagcctgac
gacaggcggcccctgggacacttcccggacattcacttcgtggaggaggccccgcggagg
agcatagaggcgttccgccagcgcctgaaccagatctcacacgacatccgccagcgcaac
aagtgccttcccatcccctactactacctggacccggtgctgattgagaacagcatttct
atttag

DBGET integrated database retrieval system