KEGG   Homo sapiens (human): 242Help
Entry
242               CDS       T01001                                 

Gene name
ALOX12B, 12R-LOX, ARCI2
Definition
arachidonate 12-lipoxygenase, 12R type (EC:1.13.11.-)
Orthology
K08021  
arachidonate 12-lipoxygenase (R-type) [EC:1.13.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Disease
H00734  
Lamellar ichthyosis (LI) and Non-bullous congenital ichthyosiform erythroderma (NBCIE)
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 701 aa AA seqDB search
MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQD
LGELIIIRLHKERYAFFPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALREATGKT
TADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPNRPEWNGY
IPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIR
KIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDDMVAPFLGE
GTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGKMMPIAIQLSQ
TPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMC
HPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLY
LPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDAAVEGDPELQSWVQEI
FKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNTGQMEFTAWMPNFPASMR
NPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPLGHFPDIHFVEEAPRR
SIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggccacctacaaagtcagggtggccacaggcaccgacctcttgtcgggaacacgggac
tccatctcactgaccattgtggggacacaaggagagagccataagcagctgctgaaccac
tttgggagagactttgcaactggggcggtgggccagtacaccgtgcagtgccctcaggac
ctgggtgagctcatcatcatccgcctgcacaaagagcggtacgccttcttccccaaggac
ccttggtactgcaactatgtgcagatctgtgcccccaacggccgtatctaccacttcccc
gcctaccagtggatggatggctacgagaccctggcactccgggaggccacaggaaagaca
acagcagatgactcgctccccgtcctcctggagcacagaaaagaggagatcagagccaag
caggacttctaccactggcgagtctttcttcctggcctgcccagctatgtgcacattccc
agttaccgccctccggtgcggaggcatcgcaaccccaaccggcctgagtggaatggctat
attccgggattcccaattctcatcaactttaaggccaccaagttcctgaacttaaatctc
cgctactccttcctcaagacggcctccttcttcgtccgcctggggcccatggcactggct
ttcaaagtccgcggcctgttggactgcaaacattcgtggaagaggctgaaggacattagg
aaaattttccctggcaagaaatctgtcgtctccgagtacgtggccgagcactgggcagag
gacaccttctttgggtaccagtacctcaacggcgtcaaccccggcctgatccgccgctgc
acgcggatcccagacaagttccccgtcacagacgacatggtggctccgttcctgggcgag
ggaacgtgcttgcaagcggagctggagaaggggaacatttacctggccgactaccgcatc
atggagggcatccccaccgtggagctcagcggccggaagcagcaccactgcgcccccctc
tgcctgctgcactttggacccgagggcaagatgatgcccatcgccatccagctcagccag
acccctgggccagattgccccatcttcctgcccagtgattctgagtgggactggctgcta
gccaagacgtgggtacgctatgcggagttctacagccacgaggccatcgcccacctgctg
gagacacacctcattgctgaggccttctgcctggccttgctgaggaacctgcccatgtgc
caccccctctacaagctcctcatcccccatacccgatacaccgtccagatcaacagcatt
ggccgggccgttctcctcaatgagggggggctctctgccaagggcatgtccctgggcgtg
gaaggctttgctggggtgatggtacgggctctgtcggagctcacctatgacagcctctac
ctccccaatgactttgtggagcgtggggtccaggacctgcctggatattactaccgcgat
gacagcttggcggtgtggaatgcactggagaagtatgtgacggagatcatcacctattat
tacccgagtgacgcagccgtggagggtgatccggaattgcagtcttgggtgcaggaaata
tttaaagagtgcctcctggggcgggagagctcaggcttccctaggtgcttgcgaaccgtg
cctgagctgatccgatatgtcactatagtcatctacacctgctctgccaagcacgctgct
gtcaacacaggccagatggagttcaccgcctggatgcccaacttcccagcgtccatgcgg
aatccaccgattcagactaaggggctgaccactctggagaccttcatggacacgttgccg
gatgtgaagaccacgtgcatcacgctgctggtgctctggaccctcagccgagagcctgac
gacaggcggcccctgggacacttcccggacattcacttcgtggaggaggccccgcggagg
agcatagaggcgttccgccagcgcctgaaccagatctcacacgacatccgccagcgcaac
aagtgccttcccatcccctactactacctggacccggtgctgattgagaacagcatttct
atttag

DBGET integrated database retrieval system