KEGG   Homo sapiens (human): 245711Help
Entry
245711            CDS       T01001                                 

Gene name
SPDYA, RINGO3, RINGOA, SPDY1, SPY1
Definition
speedy/RINGO cell cycle regulator family member A
Orthology
K08694  
speedy
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23.2
AA seq 286 aa AA seqDB search
MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPK
GPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTR
INFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRR
CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRL
GLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEGMI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacaatcagatgtgttgtgagacaccacctactgtcactgtttatgtaaaatca
gggtcaaatagatcacatcagcctaaaaagcccattactctgaagcgtcctatttgtaaa
gataattggcaagcatttgaaaaaaatacacataataacaacaaatctaaacgccccaaa
ggaccttgtctggttatacagcgtcaggatatgactgctttctttaaattatttgatgac
gatttaattcaagatttcttgtggatggactgctgctgtaaaattgcagacaagtatctt
ttggctatgacctttgtttatttcaagagggctaaatttactataagtgagcataccagg
ataaatttctttattgctctgtatctggctaatacagttgaagaagatgaagaagaaacc
aagtacgaaatttttccatgggctttagggaaaaactggagaaaattgttccctaatttc
ttaaagttaagggaccagctctgggatagaattgactatagggctattgtaagcaggcga
tgttgtgaggaggttatggccattgcaccaacccattatatctggcaaagagaacgttct
gttcatcacagtggagctgtcagaaactacaacagagatgaagttcagctgccccgggga
cctagtgccacaccagtagattgttcactctgtggtaaaaaaagaagatatgttagactg
ggattgtcttcatcatcatctttatccagtcatacagcaggggtgacagaaaaacattct
caggactcatacaactcactgtcaatggacataataggtgatccttctcaagcttatact
ggttctgaaggtatgatttag

DBGET integrated database retrieval system