KEGG   Homo sapiens (human): 245806Help
Entry
245806            CDS       T01001                                 

Gene name
VGLL2, VGL2, VITO1
Definition
(RefSeq) vestigial like family member 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8N8G2(Tbio)
UniProt: 
Position
6q22.1
AA seq 317 aa AA seqDB search
MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTP
ASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSS
KAPRSSGPWRDCSFPMSQRSFPASFWNSAYQAPVPPPLGSPLATAHSELPFAAADPYSPA
ALHGHLHQGATEPWHHAHPHHAHPHHPYALGGALGAQAAPYPRPAAVHEVYAPHFDPRYG
PLLMPAASGRPARLATAPAPAPGSPPCELSGKGEPAGAAWAGPGGPFASPSGDVAQGLGL
SVDSARRYSLCGASLLS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagctgtctggatgttatgtaccaagtctatggtcctccgcagccctacttcgcagcc
gcctacaccccctaccaccagaaactagcctattattccaaaatgcaggaagcgcaggag
tgcaatgccagccccagcagcagtggcagcggcagctcctcattttccagccaaacccca
gccagtataaaagaggaagaaggcagcccagagaaagagcgcccaccagaggcagagtac
atcaactcccgctgcgtcctcttcacttatttccagggggacatcagctccgtggtggat
gaacatttcagcagggccctgagccaacccagcagctactctcctagctgtaccagcagc
aaagcaccaaggagctctgggccctggcgagactgctccttcccgatgagccagcgcagc
ttccccgcctccttctggaatagcgcgtaccaggcgccagtgcccccgccgctgggcagc
cctctggccaccgcgcactcggagctgcccttcgccgccgccgacccctactcgcccgcc
gcgctgcatggccacctgcaccagggcgccacggagccctggcaccacgcgcacccgcac
cacgcgcacccgcatcacccctacgccctgggcggcgccctcggcgcccaggccgccccc
tacccgcgccccgccgccgtgcacgaagtctacgcgccgcacttcgacccgcgctatggg
ccgctgctgatgccagccgcctcggggcgcccggcccgcctcgcaaccgccccggcgccc
gcgcccggcagtcctccctgcgagctctccggcaaaggcgagccggcgggcgccgcgtgg
gccgggcccgggggacccttcgcgagcccctcgggggacgtggcccagggtctgggcctc
agcgtggactcagctcgtcgttattccctctgtggtgcatccctcctgagctga

DBGET integrated database retrieval system