KEGG   Homo sapiens (human): 245972Help
Entry
245972            CDS       T01001                                 

Gene name
ATP6V0D2, ATP6D2, VMA6
Definition
ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 (EC:3.6.3.14)
Orthology
K02146  
V-type H+-transporting ATPase subunit d
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Viral carcinogenesis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
Organismal Systems; Excretory system; Collecting duct acid secretion [PATH:hsa04966]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:hsa05110]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 350 aa AA seqDB search
MLEGAELYFNVDHGYLEGLVRGCKASLLTQQDYINLVQCETLEDLKIHLQTTDYGNFLAN
HTNPLTVSKIDTEMRKRLCGEFEYFRNHSLEPLSTFLTYMTCSYMIDNVILLMNGALQKK
SVKEILGKCHPLGRFTEMEAVNIAETPSDLFNAILIETPLAPFFQDCMSENALDELNIEL
LRNKLYKSYLEAFYKFCKNHGDVTAEVMCPILEFEADRRAFIITLNSFGTELSKEDRETL
YPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
NVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPIL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaggtgcggagctgtacttcaacgtggaccatggctacctggagggcctggtt
cgaggatgcaaggccagcctcctgacccagcaagactatatcaacctggtccagtgtgag
accctagaagacctgaaaattcatctccagactactgattatggtaactttttggctaat
cacacaaatcctcttactgtttccaaaattgacactgagatgaggaaaagactatgtgga
gaatttgagtatttccggaatcattccctggagcccctcagcacatttctcacctatatg
acgtgcagttatatgatagacaatgtgattctgctgatgaatggtgcattgcagaaaaaa
tctgtgaaagaaattctggggaagtgccaccccttgggccgtttcacagaaatggaagct
gtcaacattgcagagacaccttcagatctctttaatgccattctgatcgaaacgccatta
gctccattcttccaagactgcatgtctgaaaatgctctagatgaactgaatattgaattg
ctacgcaataaactatacaagtcttaccttgaggcattctataaattctgtaagaatcat
ggtgatgtcacagcagaagttatgtgtcccattcttgagtttgaggccgacagacgtgct
tttatcatcactcttaactcctttggcactgaattgagcaaagaagaccgagagaccctc
tatccaaccttcggcaaactctatcctgaggggttgcggctgttggctcaagcagaagac
tttgaccagatgaagaacgtagcggatcattacggagtatacaaacctttatttgaagct
gtaggtggcagtgggggaaagacattggaggacgtgttttacgagcgtgaggtacaaatg
aatgtgctggcattcaacagacagttccactacggtgtgttttatgcatatgtaaagctg
aaggaacaggaaattagaaatattgtgtggatagcagaatgtatttcacagaggcatcga
actaaaatcaacagttacattccaattttataa

DBGET integrated database retrieval system