KEGG   Homo sapiens (human): 245973Help
Entry
245973            CDS       T01001                                 

Gene name
ATP6V1C2, ATP6C2, VMA5
Definition
ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 (EC:3.6.3.14)
Orthology
K02148  
V-type H+-transporting ATPase subunit C
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    245973 (ATP6V1C2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    245973 (ATP6V1C2)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    245973 (ATP6V1C2)
  Nervous system
   04721 Synaptic vesicle cycle
    245973 (ATP6V1C2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    245973 (ATP6V1C2)
  Infectious diseases
   05110 Vibrio cholerae infection
    245973 (ATP6V1C2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    245973 (ATP6V1C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2
AA seq 427 aa AA seqDB search
MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKL
DTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSV
VDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEY
LVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKA
KENKFTVREFYYDEKEIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLG
NPDRPAAGQTDRERESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVN
FQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFH
IDLSLLD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagttttggttaatttctgcccctggcgataaggaaaatttgcaagctctggag
aggatgaatactgtaacctccaagtccaacctgtcttataataccaaattcgctattcct
gacttcaaggtggggaccttggattccctggttggcctctctgatgagttggggaaactc
gacacctttgctgaaagcctcataaggagaatggctcagagcgtggtggaagtcatggag
gactcaaaggggaaggtccaggagcacctcctggcaaacggagttgacttaacatccttt
gtgacccactttgaatgggacatggccaaatatcctgtcaagcagccgctcgtgagtgtg
gtggacacaatagccaagcaactggcgcagatcgagatggacctgaagtcccgaacggcc
gcctacaacactctgaagacaaacctggagaacctggaaaagaaatccatggggaacctc
ttcacccggacactgagtgatattgtgagcaaagaggacttcgtgctggattctgaatat
ctcgtcacacttctggtcatcgtccccaaaccaaactactcacaatggcaaaaaacctac
gaatctctctcagacatggtggtccctcgatcaaccaaactcattactgaggacaaggaa
gggggccttttcactgtgactctgtttcgaaaagtgattgaagatttcaaaaccaaggcc
aaagaaaacaagttcactgttcgtgaattttactatgatgagaaggaaattgaaagggaa
agggaggagatggccagattgctgtctgataagaagcaacagtatcaaacttcctgtgtt
gctcttaaaaagggatcatccaccttcccggaccacaaggttaaggtaaccccgctaggt
aaccctgataggcctgctgcggggcagaccgacagagagagagagagtgagggcgagggt
gagggccccctgctgcgctggctcaaggtgaacttcagtgaagccttcattgcctggatc
cacatcaaggccctgagagtgtttgtggagtccgtgctcaggtatggactaccagtgaac
ttccaggcagtgctcctgcagccgcataagaagtcatccaccaagcgtttaagagaggtt
ctaaactctgtcttccgacatctggatgaagtagccgctacaagtatactggatgcatct
gtggagatcccgggactgcaactcaataaccaagactattttccttatgtctacttccat
attgaccttagtcttcttgactag

DBGET integrated database retrieval system