KEGG   Homo sapiens (human): 246Help
Entry
246               CDS       T01001                                 

Gene name
ALOX15, 12-LOX, 15-LOX-1, 15LOX-1
Definition
arachidonate 15-lipoxygenase (EC:1.13.11.31 1.13.11.33)
Orthology
K00460  
arachidonate 15-lipoxygenase [EC:1.13.11.33]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:hsa00591]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.3
AA seq 662 aa AA seqDB search
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPL
LFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP
QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK
GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV
LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH
LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS
LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH
ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV
AI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgggtctctaccgcatccgcgtgtccactggggcctcgctctatgccggttccaacaac
caggtgcagctgtggctggtcggccagcacggggaggcggcgctcgggaagcgactgtgg
cccgcacggggcaaggagacagaactcaaggtggaagtaccggagtatctggggccgctg
ctgtttgtgaaactgcgcaaacggcacctccttaaggacgacgcctggttctgcaactgg
atctctgtgcagggccccggagccggggacgaggtcaggttcccttgttaccgctgggtg
gagggcaacggcgtcctgagcctgcctgaaggcaccggccgcactgtgggcgaggaccct
cagggcctgttccagaaacaccgggaagaagagctggaagagagaaggaagttgtaccgg
tggggaaactggaaggacgggttaattctgaatatggctggggccaaactatatgacctc
cctgtggatgagcgatttctggaagacaagagagttgactttgaggtttcgctggccaag
gggctggccgacctcgctatcaaagactctctaaatgttctgacttgctggaaggatcta
gatgacttcaaccggattttctggtgtggtcagagcaagctggctgagcgcgtgcgggac
tcctggaaggaagatgccttatttgggtaccagtttcttaatggcgccaaccccgtggtg
ctgaggcgctctgctcaccttcctgctcgcctagtgttccctccaggcatggaggaactg
caggcccagctggagaaggagctggagggaggcacactgttcgaagctgacttctccctg
ctggatgggatcaaggccaacgtcattctctgtagccagcagcacctggctgcccctcta
gtcatgctgaaattgcagcctgatgggaaactcttgcccatggtcatccagctccagctg
ccccgcacaggatccccaccacctccccttttcttgcctacggatcccccaatggcctgg
cttctggccaaatgctgggtgcgcagctctgacttccagctccatgagctgcagtctcat
cttctgaggggacacttgatggctgaggtcattgttgtggccaccatgaggtgcctgccg
tcgatacatcctatcttcaagcttataattccccacctgcgatacaccctggaaattaac
gtccgggccaggactgggctggtctctgacatgggaattttcgaccagataatgagcact
ggtgggggaggccacgtgcagctgctcaagcaagctggagccttcctaacctacagctcc
ttctgtccccctgatgacttggccgaccgggggctcctgggagtgaagtcttccttctat
gcccaagatgcgctgcggctctgggaaatcatctatcggtatgtggaaggaatcgtgagt
ctccactataagacagacgtggctgtgaaagacgacccagagctgcagacctggtgtcga
gagatcactgaaatcgggctgcaaggggcccaggaccgagggtttcctgtctctttacag
gctcgggaccaggtttgccactttgtcaccatgtgtatcttcacctgcaccggccaacac
gcctctgtgcacctgggccagctggactggtactcttgggtgcctaatgcaccctgcacg
atgcggctgcccccgccaaccaccaaggatgcaacgctggagacagtgatggcgacactg
cccaacttccaccaggcttctctccagatgtccatcacttggcagctgggcagacgccag
cccgttatggtggctgtgggccagcatgaggaggagtatttttcgggccctgagcctaag
gctgtgctgaagaagttcagggaggagctggctgccctggataaggaaattgagatccgg
aatgcaaagctggacatgccctacgagtacctgcggcccagcgtggtggaaaacagtgtg
gccatctaa

DBGET integrated database retrieval system