KEGG   Homo sapiens (human): 246Help
Entry
246               CDS       T01001                                 

Gene name
ALOX15, 12-LOX, 15-LOX-1, 15LOX-1
Definition
(RefSeq) arachidonate 15-lipoxygenase
  KO
K00460  
arachidonate 15-lipoxygenase [EC:1.13.11.33]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Ferroptosis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    246 (ALOX15)
   00591 Linoleic acid metabolism
    246 (ALOX15)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    246 (ALOX15)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    246 (ALOX15)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.33  arachidonate 15-lipoxygenase
     246 (ALOX15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P16050(Tchem)
UniProt: 
Position
17p13.2
AA seq 662 aa AA seqDB search
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPL
LFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP
QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK
GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV
LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH
LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS
LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH
ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV
AI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgggtctctaccgcatccgcgtgtccactggggcctcgctctatgccggttccaacaac
caggtgcagctgtggctggtcggccagcacggggaggcggcgctcgggaagcgactgtgg
cccgcacggggcaaggagacagaactcaaggtggaagtaccggagtatctggggccgctg
ctgtttgtgaaactgcgcaaacggcacctccttaaggacgacgcctggttctgcaactgg
atctctgtgcagggccccggagccggggacgaggtcaggttcccttgttaccgctgggtg
gagggcaacggcgtcctgagcctgcctgaaggcaccggccgcactgtgggcgaggaccct
cagggcctgttccagaaacaccgggaagaagagctggaagagagaaggaagttgtaccgg
tggggaaactggaaggacgggttaattctgaatatggctggggccaaactatatgacctc
cctgtggatgagcgatttctggaagacaagagagttgactttgaggtttcgctggccaag
gggctggccgacctcgctatcaaagactctctaaatgttctgacttgctggaaggatcta
gatgacttcaaccggattttctggtgtggtcagagcaagctggctgagcgcgtgcgggac
tcctggaaggaagatgccttatttgggtaccagtttcttaatggcgccaaccccgtggtg
ctgaggcgctctgctcaccttcctgctcgcctagtgttccctccaggcatggaggaactg
caggcccagctggagaaggagctggagggaggcacactgttcgaagctgacttctccctg
ctggatgggatcaaggccaacgtcattctctgtagccagcagcacctggctgcccctcta
gtcatgctgaaattgcagcctgatgggaaactcttgcccatggtcatccagctccagctg
ccccgcacaggatccccaccacctccccttttcttgcctacggatcccccaatggcctgg
cttctggccaaatgctgggtgcgcagctctgacttccagctccatgagctgcagtctcat
cttctgaggggacacttgatggctgaggtcattgttgtggccaccatgaggtgcctgccg
tcgatacatcctatcttcaagcttataattccccacctgcgatacaccctggaaattaac
gtccgggccaggactgggctggtctctgacatgggaattttcgaccagataatgagcact
ggtgggggaggccacgtgcagctgctcaagcaagctggagccttcctaacctacagctcc
ttctgtccccctgatgacttggccgaccgggggctcctgggagtgaagtcttccttctat
gcccaagatgcgctgcggctctgggaaatcatctatcggtatgtggaaggaatcgtgagt
ctccactataagacagacgtggctgtgaaagacgacccagagctgcagacctggtgtcga
gagatcactgaaatcgggctgcaaggggcccaggaccgagggtttcctgtctctttacag
gctcgggaccaggtttgccactttgtcaccatgtgtatcttcacctgcaccggccaacac
gcctctgtgcacctgggccagctggactggtactcttgggtgcctaatgcaccctgcacg
atgcggctgcccccgccaaccaccaaggatgcaacgctggagacagtgatggcgacactg
cccaacttccaccaggcttctctccagatgtccatcacttggcagctgggcagacgccag
cccgttatggtggctgtgggccagcatgaggaggagtatttttcgggccctgagcctaag
gctgtgctgaagaagttcagggaggagctggctgccctggataaggaaattgagatccgg
aatgcaaagctggacatgccctacgagtacctgcggcccagcgtggtggaaaacagtgtg
gccatctaa

DBGET integrated database retrieval system