KEGG   Homo sapiens (human): 246184Help
Entry
246184            CDS       T01001                                 

Gene name
CDC26, ANAPC12, APC12, C9orf17
Definition
cell division cycle 26
Orthology
K03359  
anaphase-promoting complex subunit 12
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    246184 (CDC26)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    246184 (CDC26)
   04114 Oocyte meiosis
    246184 (CDC26)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    246184 (CDC26)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    246184 (CDC26)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     246184 (CDC26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q32
AA seq 85 aa AA seqDB search
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQM
INDRIGYKPQPKPNNRSSQFGSLEF
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgctgagacggaaaccaacacgcctagagctaaagcttgatgacattgaagagtttgag
aacattcgaaaggacctggagacccgtaagaaacagaaggaagatgtggaagttgtagga
ggcagtgatggagaaggagccattgggcttagcagtgatcccaagagccgggaacaaatg
atcaatgatcggattggttataaaccccaacccaagcccaataatcgttcatctcaattt
ggaagtcttgaattttag

DBGET integrated database retrieval system