KEGG   Homo sapiens (human): 246213Help
Entry
246213            CDS       T01001                                 

Gene name
SLC17A8, DFNA25, VGLUT3
Definition
solute carrier family 17 (vesicular glutamate transporter), member 8
Orthology
K12302  
MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
Glutamatergic synapse
Nicotine addiction
Disease
H00604  
Deafness, autosomal dominant
Class
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Substance dependence; Nicotine addiction [PATH:hsa05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q23.1
AA seq 539 aa AA seqDB search
MPFKAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRP
SPPLCDCHCCGLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTA
QFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV
HYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGV
LVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSL
SVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFS
HTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGA
MTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAE
EIELNHESFASPKKKMSYGATSQNCEVQKKEWKGQRGATLDEEELTSYQNEERNFSTIS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgccttttaaagcatttgataccttcaaagaaaaaattctgaaacctgggaaggaagga
gtgaagaacgccgtgggagattctttgggaattttacaaagaaaaatcgatgggacaact
gaggaagaagataacattgagctgaatgaagaaggaaggccggtgcagacgtccaggcca
agccccccactctgcgactgccactgctgcggcctccccaagcgttacatcattgctatc
atgagtgggctgggattctgcatttcctttgggatccggtgcaatcttggagttgccatt
gtggaaatggtcaacaatagcaccgtatatgttgatggaaaaccggaaattcagacagca
cagtttaactgggatccagaaacagtgggccttatccatggatcttttttctggggctat
attatgacacaaattccaggtggtttcatttcaaacaagtttgctgctaacagggtcttt
ggagctgccatcttcttaacatcgactctgaacatgtttattccctctgcagccagagtg
cattacggatgcgtcatgtgtgtcagaattctgcaaggtttagtggagggtgtgacctac
ccagcctgccatgggatgtggagtaagtgggcaccacctttggagagaagccgactggcc
acaacctctttttgtggttcctatgcaggggcagtggttgccatgcccctggctggggtg
ttggtgcagtacattggatggtcctctgtcttttatatttatggcatgtttgggattatt
tggtacatgttttggctgttgcaggcctatgagtgcccagcagctcatccaacaatatcc
aatgaggagaagacctatatagagacaagcataggagagggggccaacgtggttagtcta
agtgtgggtctcttgtcagcagtcccacacatggttatgacaatcgttgtacctattgga
ggacaattggctgattatttaagaagcagacaaattttaaccacaactgctgtcagaaaa
atcatgaactgtggaggttttggcatggaggcaaccttactcctggtggttggcttttcg
cataccaaaggggtggctatctcctttctggtacttgctgtaggatttagtggcttcgct
atttcaggttttaatgtcaaccacctggacattgccccacgctatgccagcattctcatg
gggatctcaaacggagtgggaaccctctctggaatggtctgtcccctcattgtcggtgca
atgaccaggcacaagacccgtgaagaatggcagaatgtgttcctcatagctgccctggtg
cattacagtggtgtgatcttctatggggtctttgcttctggggagaaacaggagtgggct
gacccagagaatctctctgaggagaaatgtggaatcattgaccaggacgaattagctgag
gagatagaactcaaccatgagagttttgcgagtcccaaaaagaagatgtcttatggagcc
acctcccagaattgtgaagtccagaagaaggaatggaaaggacagagaggagcgaccctt
gatgaggaagagctgacatcctaccagaatgaagagagaaacttctcaactatatcctaa

DBGET integrated database retrieval system