KEGG   Homo sapiens (human): 246213Help
Entry
246213            CDS       T01001                                 

Gene name
SLC17A8, DFNA25, VGLUT3
Definition
solute carrier family 17 (vesicular glutamate transporter), member 8
Orthology
K12302  
MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
Glutamatergic synapse
Nicotine addiction
Disease
H00604  
Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    246213 (SLC17A8)
   04723 Retrograde endocannabinoid signaling
    246213 (SLC17A8)
   04721 Synaptic vesicle cycle
    246213 (SLC17A8)
 Human Diseases
  Substance dependence
   05033 Nicotine addiction
    246213 (SLC17A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q23.1
AA seq 539 aa AA seqDB search
MPFKAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRP
SPPLCDCHCCGLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTA
QFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV
HYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGV
LVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSL
SVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFS
HTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGA
MTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAE
EIELNHESFASPKKKMSYGATSQNCEVQKKEWKGQRGATLDEEELTSYQNEERNFSTIS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgccttttaaagcatttgataccttcaaagaaaaaattctgaaacctgggaaggaagga
gtgaagaacgccgtgggagattctttgggaattttacaaagaaaaatcgatgggacaact
gaggaagaagataacattgagctgaatgaagaaggaaggccggtgcagacgtccaggcca
agccccccactctgcgactgccactgctgcggcctccccaagcgttacatcattgctatc
atgagtgggctgggattctgcatttcctttgggatccggtgcaatcttggagttgccatt
gtggaaatggtcaacaatagcaccgtatatgttgatggaaaaccggaaattcagacagca
cagtttaactgggatccagaaacagtgggccttatccatggatcttttttctggggctat
attatgacacaaattccaggtggtttcatttcaaacaagtttgctgctaacagggtcttt
ggagctgccatcttcttaacatcgactctgaacatgtttattccctctgcagccagagtg
cattacggatgcgtcatgtgtgtcagaattctgcaaggtttagtggagggtgtgacctac
ccagcctgccatgggatgtggagtaagtgggcaccacctttggagagaagccgactggcc
acaacctctttttgtggttcctatgcaggggcagtggttgccatgcccctggctggggtg
ttggtgcagtacattggatggtcctctgtcttttatatttatggcatgtttgggattatt
tggtacatgttttggctgttgcaggcctatgagtgcccagcagctcatccaacaatatcc
aatgaggagaagacctatatagagacaagcataggagagggggccaacgtggttagtcta
agtgtgggtctcttgtcagcagtcccacacatggttatgacaatcgttgtacctattgga
ggacaattggctgattatttaagaagcagacaaattttaaccacaactgctgtcagaaaa
atcatgaactgtggaggttttggcatggaggcaaccttactcctggtggttggcttttcg
cataccaaaggggtggctatctcctttctggtacttgctgtaggatttagtggcttcgct
atttcaggttttaatgtcaaccacctggacattgccccacgctatgccagcattctcatg
gggatctcaaacggagtgggaaccctctctggaatggtctgtcccctcattgtcggtgca
atgaccaggcacaagacccgtgaagaatggcagaatgtgttcctcatagctgccctggtg
cattacagtggtgtgatcttctatggggtctttgcttctggggagaaacaggagtgggct
gacccagagaatctctctgaggagaaatgtggaatcattgaccaggacgaattagctgag
gagatagaactcaaccatgagagttttgcgagtcccaaaaagaagatgtcttatggagcc
acctcccagaattgtgaagtccagaagaaggaatggaaaggacagagaggagcgaccctt
gatgaggaagagctgacatcctaccagaatgaagagagaaacttctcaactatatcctaa

DBGET integrated database retrieval system