KEGG   Homo sapiens (human): 2488Help
Entry
2488              CDS       T01001                                 

Gene name
FSHB
Definition
follicle stimulating hormone, beta polypeptide
Orthology
K05250  
follicle stimulating hormone
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
GnRH signaling pathway
Ovarian steroidogenesis
Disease
H01253  
Isolated follicle-stimulating hormone deficiency (IFSHD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    2488 (FSHB)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2488 (FSHB)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    2488 (FSHB)
   04913 Ovarian Steroidogenesis
    2488 (FSHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p13
AA seq 129 aa AA seqDB search
MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP
ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS
YCSFGEMKE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaagacactccagtttttcttccttttctgttgctggaaagcaatctgctgcaatagc
tgtgagctgaccaacatcaccattgcaatagagaaagaagaatgtcgtttctgcataagc
atcaacaccacttggtgtgctggctactgctacaccagggatctggtgtataaggaccca
gccaggcccaaaatccagaaaacatgtaccttcaaggaactggtatacgaaacagtgaga
gtgcccggctgtgctcaccatgcagattccttgtatacatacccagtggccacccagtgt
cactgtggcaagtgtgacagcgacagcactgattgtactgtgcgaggcctggggcccagc
tactgctcctttggtgaaatgaaagaataa

DBGET integrated database retrieval system