KEGG   Homo sapiens (human): 2488Help
Entry
2488              CDS       T01001                                 

Gene name
FSHB, HH24
Definition
(RefSeq) follicle stimulating hormone, beta polypeptide
  KO
K05250  
follicle stimulating hormone
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
GnRH signaling pathway
Ovarian steroidogenesis
Disease
H01253  
Isolated follicle-stimulating hormone deficiency (IFSHD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    2488 (FSHB)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2488 (FSHB)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    2488 (FSHB)
   04913 Ovarian Steroidogenesis
    2488 (FSHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p13
AA seq 129 aa AA seqDB search
MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP
ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS
YCSFGEMKE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaagacactccagtttttcttccttttctgttgctggaaagcaatctgctgcaatagc
tgtgagctgaccaacatcaccattgcaatagagaaagaagaatgtcgtttctgcataagc
atcaacaccacttggtgtgctggctactgctacaccagggatctggtgtataaggaccca
gccaggcccaaaatccagaaaacatgtaccttcaaggaactggtatacgaaacagtgaga
gtgcccggctgtgctcaccatgcagattccttgtatacatacccagtggccacccagtgt
cactgtggcaagtgtgacagcgacagcactgattgtactgtgcgaggcctggggcccagc
tactgctcctttggtgaaatgaaagaataa

DBGET integrated database retrieval system