KEGG   Homo sapiens (human): 2492Help
Entry
2492              CDS       T01001                                 

Gene name
FSHR, FSHRO, LGR1, ODG1
Definition
follicle stimulating hormone receptor
Orthology
K04247  
follicle stimulating hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Ovarian steroidogenesis
Disease
H00598  
46,XX disorders of sex development (Disorders of gonadal development)
H00627  
Premature ovarian failure
H01039  
Ovarian hyperstimulation syndrome (OHSS)
Drug target
Chorionic gonadotrophin: 
Human menopausal gonadotrophin: 
Serum gonadotrophin: 
Urofollitropin: 
Follitropin alfa: 
Follitropin beta: 
Corifollitropin alfa: 
Combinations: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2492 (FSHR)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    2492 (FSHR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Follicle stimulating hormone
    2492 (FSHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p21-p16
AA seq 695 aa AA seqDB search
MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRV
IQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
NLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKN
GIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLEN
LKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQE
VDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIM
GYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIAS
VDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCK
VQLRHAASVMVMGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVL
AFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVP
LITVSKAKILLVLFHPINSCANPFLYAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETSS
TVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctcctggtctctttgctggcattcctgagcttgggctcaggatgtcatcat
cggatctgtcactgctctaacagggtttttctctgccaagagagcaaggtgacagagatt
ccttctgacctcccgaggaatgccattgaactgaggtttgtcctcaccaagcttcgagtc
atccaaaaaggtgcattttcaggatttggggacctggagaaaatagagatctctcagaat
gatgtcttggaggtgatagaggcagatgtgttctccaaccttcccaaattacatgaaatt
agaattgaaaaggccaacaacctgctctacatcaaccctgaggccttccagaaccttccc
aaccttcaatatctgttaatatccaacacaggtattaagcaccttccagatgttcacaag
attcattctctccaaaaagttttacttgacattcaagataacataaacatccacacaatt
gaaagaaattctttcgtggggctgagctttgaaagtgtgattctatggctgaataagaat
gggattcaagaaatacacaactgtgcattcaatggaacccaactagatgagctgaatcta
agcgataataataatttagaagaattgcctaatgatgttttccacggagcctctggacca
gtcattctagatatttcaagaacaaggatccattccctgcctagctatggcttagaaaat
cttaagaagctgagggccaggtcgacttacaacttaaaaaagctgcctactctggaaaag
cttgtcgccctcatggaagccagcctcacctatcccagccattgctgtgcctttgcaaac
tggagacggcaaatctctgagcttcatccaatttgcaacaaatctattttaaggcaagaa
gttgattatatgactcaggctaggggtcagagatcctctctggcagaagacaatgagtcc
agctacagcagaggatttgacatgacgtacactgagtttgactatgacttatgcaatgaa
gtggttgacgtgacctgctcccctaagccagatgcattcaacccatgtgaagatatcatg
gggtacaacatcctcagagtcctgatatggtttatcagcatcctggccatcactgggaac
atcatagtgctagtgatcctaactaccagccaatataaactcacagtccccaggttcctt
atgtgcaacctggcctttgctgatctctgcattggaatctacctgctgctcattgcatca
gttgatatccataccaagagccaatatcacaactatgccattgactggcaaactggggca
ggctgtgatgctgctggctttttcactgtctttgccagtgagctgtcagtctacactctg
acagctatcaccttggaaagatggcataccatcacgcatgccatgcagctggactgcaag
gtgcagctccgccatgctgccagtgtcatggtgatgggctggatttttgcttttgcagct
gccctctttcccatctttggcatcagcagctacatgaaggtgagcatctgcctgcccatg
gatattgacagccctttgtcacagctgtatgtcatgtccctccttgtgctcaatgtcctg
gcctttgtggtcatctgtggctgctatatccacatctacctcacagtgcggaaccccaac
atcgtgtcctcctctagtgacaccaggatcgccaagcgcatggccatgctcatcttcact
gacttcctctgcatggcacccatttctttctttgccatttctgcctccctcaaggtgccc
ctcatcactgtgtccaaagcaaagattctgctggttctgtttcaccccatcaactcctgt
gccaaccccttcctctatgccatctttaccaaaaactttcgcagagatttcttcattctg
ctgagcaagtgtggctgctatgaaatgcaagcccaaatttataggacagaaacttcatcc
actgtccacaacacccatccaaggaatggccactgctcttcagctcccagagtcaccagt
ggttccacttacatacttgtccctctaagtcatttagcccaaaactaa

DBGET integrated database retrieval system