KEGG   Homo sapiens (human): 2492Help
Entry
2492              CDS       T01001                                 

Gene name
FSHR, FSHRO, LGR1, ODG1
Definition
follicle stimulating hormone receptor
Orthology
K04247  
follicle stimulating hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Ovarian steroidogenesis
Disease
H00598  
46,XX disorders of sex development (Disorders of gonadal development)
H00627  
Premature ovarian failure
H01039  
Ovarian hyperstimulation syndrome (OHSS)
Drug target
Chorionic gonadotrophin: 
Human menopausal gonadotrophin: 
Serum gonadotrophin: 
Urofollitropin: 
Follitropin alfa: 
Follitropin beta: 
Corifollitropin alfa: 
Combinations: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    2492 (FSHR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2492 (FSHR)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    2492 (FSHR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Follicle stimulating hormone
    2492 (FSHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p21-p16
AA seq 695 aa AA seqDB search
MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRV
IQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
NLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKN
GIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLEN
LKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQE
VDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIM
GYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIAS
VDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCK
VQLRHAASVMVMGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVL
AFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVP
LITVSKAKILLVLFHPINSCANPFLYAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETSS
TVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctcctggtctctttgctggcattcctgagcttgggctcaggatgtcatcat
cggatctgtcactgctctaacagggtttttctctgccaagagagcaaggtgacagagatt
ccttctgacctcccgaggaatgccattgaactgaggtttgtcctcaccaagcttcgagtc
atccaaaaaggtgcattttcaggatttggggacctggagaaaatagagatctctcagaat
gatgtcttggaggtgatagaggcagatgtgttctccaaccttcccaaattacatgaaatt
agaattgaaaaggccaacaacctgctctacatcaaccctgaggccttccagaaccttccc
aaccttcaatatctgttaatatccaacacaggtattaagcaccttccagatgttcacaag
attcattctctccaaaaagttttacttgacattcaagataacataaacatccacacaatt
gaaagaaattctttcgtggggctgagctttgaaagtgtgattctatggctgaataagaat
gggattcaagaaatacacaactgtgcattcaatggaacccaactagatgagctgaatcta
agcgataataataatttagaagaattgcctaatgatgttttccacggagcctctggacca
gtcattctagatatttcaagaacaaggatccattccctgcctagctatggcttagaaaat
cttaagaagctgagggccaggtcgacttacaacttaaaaaagctgcctactctggaaaag
cttgtcgccctcatggaagccagcctcacctatcccagccattgctgtgcctttgcaaac
tggagacggcaaatctctgagcttcatccaatttgcaacaaatctattttaaggcaagaa
gttgattatatgactcaggctaggggtcagagatcctctctggcagaagacaatgagtcc
agctacagcagaggatttgacatgacgtacactgagtttgactatgacttatgcaatgaa
gtggttgacgtgacctgctcccctaagccagatgcattcaacccatgtgaagatatcatg
gggtacaacatcctcagagtcctgatatggtttatcagcatcctggccatcactgggaac
atcatagtgctagtgatcctaactaccagccaatataaactcacagtccccaggttcctt
atgtgcaacctggcctttgctgatctctgcattggaatctacctgctgctcattgcatca
gttgatatccataccaagagccaatatcacaactatgccattgactggcaaactggggca
ggctgtgatgctgctggctttttcactgtctttgccagtgagctgtcagtctacactctg
acagctatcaccttggaaagatggcataccatcacgcatgccatgcagctggactgcaag
gtgcagctccgccatgctgccagtgtcatggtgatgggctggatttttgcttttgcagct
gccctctttcccatctttggcatcagcagctacatgaaggtgagcatctgcctgcccatg
gatattgacagccctttgtcacagctgtatgtcatgtccctccttgtgctcaatgtcctg
gcctttgtggtcatctgtggctgctatatccacatctacctcacagtgcggaaccccaac
atcgtgtcctcctctagtgacaccaggatcgccaagcgcatggccatgctcatcttcact
gacttcctctgcatggcacccatttctttctttgccatttctgcctccctcaaggtgccc
ctcatcactgtgtccaaagcaaagattctgctggttctgtttcaccccatcaactcctgt
gccaaccccttcctctatgccatctttaccaaaaactttcgcagagatttcttcattctg
ctgagcaagtgtggctgctatgaaatgcaagcccaaatttataggacagaaacttcatcc
actgtccacaacacccatccaaggaatggccactgctcttcagctcccagagtcaccagt
ggttccacttacatacttgtccctctaagtcatttagcccaaaactaa

DBGET integrated database retrieval system