KEGG   Homo sapiens (human): 2494Help
Entry
2494              CDS       T01001                                 

Gene name
NR5A2, B1F, B1F2, CPF, FTF, FTZ-F1, FTZ-F1beta, LRH-1, LRH1, hB1F-2
Definition
nuclear receptor subfamily 5, group A, member 2
Orthology
K08027  
nuclear receptor subfamily 5 group A member 2
Organism
hsa  Homo sapiens (human)
Pathway
Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    2494 (NR5A2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Fushi tarazu-F1-like
    2494 (NR5A2)
Nuclear receptors [BR:hsa03310]
 5. Fushi tarazu-F1 like
  5A. Fushi tarazu-F1 like receptor
   2494 (NR5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.1
AA seq 469 aa AA seqDB search
MVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDK
TQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLK
LEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPH
GSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCE
PDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVD
DQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQ
ELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQ
TEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggtgaattactcctatgatgaagatctggaagagctttgtcccgtgtgtggagataaa
gtgtctgggtaccattatgggctcctcacctgtgaaagctgcaagggattttttaagcga
acagtccaaaataataaaaggtacacatgtatagaaaaccagaactgccaaattgacaaa
acacagagaaagcgttgtccttactgtcgttttcaaaaatgtctaagtgttggaatgaag
ctagaagctgtaagggccgaccgaatgcgtggaggaaggaataagtttgggccaatgtac
aagagagacagggccctgaagcaacagaaaaaagccctcatccgagccaatggacttaag
ctagaagccatgtctcaggtgatccaagctatgccctctgacctgaccatttcctctgca
attcaaaacatccactctgcctccaaaggcctacctctgaaccatgctgccttgcctcct
acagactatgacagaagtccctttgtaacatcccccattagcatgacaatgccccctcac
ggcagcctgcaaggttaccaaacatatggccactttcctagccgggccatcaagtctgag
tacccagacccctataccagctcacccgagtccataatgggctattcatatatggatagt
taccagacgagctctccagcaagcatcccacatctgatactggaacttttgaagtgtgag
ccagatgagcctcaagtccaggctaaaatcatggcctatttgcagcaagagcaggctaac
cgaagcaagcacgaaaagctgagcacctttgggcttatgtgcaaaatggcagatcaaact
ctcttctccattgtcgagtgggccaggagtagtatcttcttcagagaacttaaggttgat
gaccaaatgaagctgcttcagaactgctggagtgagctcttaatcctcgaccacatttac
cgacaagtggtacatggaaaggaaggatccatcttcctggttactgggcaacaagtggac
tattccataatagcatcacaagccggagccaccctcaacaacctcatgagtcatgcacag
gagttagtggcaaaacttcgttctctccagtttgatcaacgagagttcgtatgtctgaaa
ttcttggtgctctttagtttagatgtcaaaaaccttgaaaacttccagctggtagaaggt
gtccaggaacaagtcaatgccgccctgctggactacacaatgtgtaactacccgcagcag
acagagaaatttggacagctacttcttcgactacccgaaatccgggccatcagtatgcag
gctgaagaatacctctactacaagcacctgaacggggatgtgccctataataaccttctc
attgaaatgttgcatgccaaaagagcataa

DBGET integrated database retrieval system