KEGG   Homo sapiens (human): 251Help
Entry
251               CDS       T01001                                 

Gene name
ALPPL2, ALPG, ALPPL, GCAP
Definition
alkaline phosphatase, placental-like 2 (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    251 (ALPPL2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     251 (ALPPL2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   251 (ALPPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37
AA seq 532 aa AA seqDB search
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctcctgctgggcctgaggctacagctctccctgggcatc
atcccagttgaggaggagaacccggacttctggaaccgccaggcagccgaggccctgggt
gccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatcttcctgggt
gacgggatgggggtgtctacggtgacagctgccaggatcctaaaagggcagaagaaggac
aaactggggcctgagaccttcctggccatggaccgcttcccgtacgtggctctgtccaag
acatacagtgtagacaagcatgtgccagacagtggagccacagccacggcctacctgtgc
ggggtcaagggcaacttccagaccattggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaagcaggaaag
tcagtgggagtggtaaccaccacacgggtgcagcatgcctcgccagccggcgcctacgcc
cacacggtgaaccgcaactggtactcggatgccgacgtgcctgcctcggcccgccaggag
gggtgccaggacatcgccacgcagctcatctccaacatggacattgatgtgatcctaggt
ggaggccgaaagtacatgtttcccatggggaccccagaccctgagtacccagatgactac
agccaaggtgggaccaggctggacgggaagaatctggtgcaggaatggctggcgaagcac
cagggtgcccggtacgtgtggaaccgcactgagctcctgcaggcttccctggacccgtct
gtgacccatctcatgggtctctttgagcctggagacatgaaatacgagatccaccgagac
tccacactggacccctccctgatggagatgacagaggctgccctgctcctgctgagcagg
aacccccgcggcttcttcctcttcgtggagggtggtcgcatcgaccatggtcatcatgaa
agcagggcttaccgggcactgactgagacgatcatgttcgacgacgccattgagagggcg
ggccagctcaccagcgaggaggacacgctgagcctcgtcactgccgaccactcccacgtc
ttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcccctggcaag
gcccgggacaggaaggcctacacggtcctcctatacggaaacggtccaggctatgtgctc
aaggacggcgcccggccggatgttacggagagcgagagcgggagccccgagtatcggcag
cagtcagcagtgcccctggacggagagacccacgcaggcgaggacgtggcggtgttcgcg
cgcggcccgcaggcgcacctggttcacggcgtgcaggagcagaccttcatagcgcacgtc
atggccttcgccgcctgcctggagccctacaccgcctgcgacctggcgccccgcgccggc
accaccgacgccgcgcacccggggccgtccgtggtccccgcgttgcttcctctgctggca
gggaccttgctgctgctggggacggccactgctccctga

DBGET integrated database retrieval system