KEGG   Homo sapiens (human): 2516Help
Entry
2516              CDS       T01001                                 

Gene name
NR5A1, AD4BP, ELP, FTZ1, FTZF1, POF7, SF-1, SF1, SPGF8, SRXX4, SRXY3, hSF-1
Definition
(RefSeq) nuclear receptor subfamily 5 group A member 1
  KO
K08560  
steroidogenic factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Cortisol synthesis and secretion
Disease
H00607  
46,XY disorders of sex development (Disorders of gonadal development)
H00627  
Premature ovarian failure
H01282  
Spermatogenic failure
H01772  
Adrenal hypoplasia congenita, ingluding:
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04927 Cortisol synthesis and secretion
    2516 (NR5A1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Fushi tarazu-F1-like
    2516 (NR5A1)
Nuclear receptors [BR:hsa03310]
 5. Fushi tarazu-F1 like
  5A. Fushi tarazu-F1 like receptor
   2516 (NR5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13285(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
9q33.3
AA seq 461 aa AA seqDB search
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPMGVPPPPPPAPDYVLPPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPL
AGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQV
RARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLA
LQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLL
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggactattcgtacgacgaggacctggacgagctgtgccccgtgtgcggggacaaggtg
tccggctaccactacggactgctcacgtgtgagagctgcaagggcttcttcaagcgcacg
gtgcagaacaacaagcactacacgtgcaccgagagccagagctgcaagatcgacaagacg
cagcgcaagcgctgtcccttctgccgcttccagaaatgcctgacggtggggatgcgcctg
gaagccgtgcgcgctgaccgtatgaggggtggccggaacaagtttgggccgatgtacaag
cgggaccgggccctgaaacagcagaagaaggcacagattcgggccaatggcttcaagctg
gagacagggcccccgatgggggtgcccccgccgccccctcccgcaccggactacgtgctg
cctcccagcctgcatgggcctgagcccaagggcctggccgccggtccacctgctgggcca
ctgggcgactttggggccccagcactgcccatggccgtgcccggtgcccacgggccactg
gctggctacctctaccctgcctttcctggccgtgccatcaagtctgagtacccggagcct
tatgccagccccccacagcctgggctgccgtacggctacccagagcccttctctggaggg
cccaacgtgcctgagctcatcctgcagctgctgcagctggagccggatgaggaccaggtg
cgggcccgcatcttgggctgcctgcaggagcccaccaaaagccgccccgaccagccggcg
gccttcggcctcctgtgcagaatggccgaccagaccttcatctccatcgtggactgggca
cgcaggtgcatggtcttcaaggagctggaggtggccgaccagatgacgctgctgcagaac
tgctggagcgagctgctggtgttcgaccacatctaccgccaggtccagcacggcaaggag
ggcagcatcctgctggtcaccgggcaggaggtggagctgaccacagtggccacccaggcg
ggctcgctgctgcacagcctggtgttgcgggcgcaggagctggtgctgcagctgcttgcg
ctgcagctggaccggcaggagtttgtctgcctcaagttcatcatcctcttcagcctggat
ttgaagttcctgaataaccacatcctggtgaaagacgctcaggagaaggccaacgccgcc
ctgcttgactacaccctgtgccactacccgcactgcggggacaaattccagcagctgctg
ctgtgcctggtggaggtgcgggccctgagcatgcaggccaaggagtacctgtaccacaag
cacctgggcaacgagatgccccgcaacaacctgctcatcgaaatgctgcaagccaagcag
acttga

DBGET integrated database retrieval system