KEGG   Homo sapiens (human): 2516Help
Entry
2516              CDS       T01001                                 

Gene name
NR5A1, AD4BP, ELP, FTZ1, FTZF1, POF7, SF-1, SF1, SPGF8, SRXX4, SRXY3, hSF-1
Definition
(RefSeq) nuclear receptor subfamily 5 group A member 1
  KO
K08560  
steroidogenic factor 1
Organism
hsa  Homo sapiens (human)
Disease
H00607  
46,XY disorders of sex development (Disorders of gonadal development)
H00627  
Premature ovarian failure
H01282  
Spermatogenic failure
H01772  
Adrenal hypoplasia congenita, ingluding:
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Fushi tarazu-F1-like
    2516 (NR5A1)
Nuclear receptors [BR:hsa03310]
 5. Fushi tarazu-F1 like
  5A. Fushi tarazu-F1 like receptor
   2516 (NR5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13285(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
9q33.3
AA seq 461 aa AA seqDB search
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPMGVPPPPPPAPDYVLPPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPL
AGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQV
RARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLA
LQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLL
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggactattcgtacgacgaggacctggacgagctgtgccccgtgtgcggggacaaggtg
tccggctaccactacggactgctcacgtgtgagagctgcaagggcttcttcaagcgcacg
gtgcagaacaacaagcactacacgtgcaccgagagccagagctgcaagatcgacaagacg
cagcgcaagcgctgtcccttctgccgcttccagaaatgcctgacggtggggatgcgcctg
gaagccgtgcgcgctgaccgtatgaggggtggccggaacaagtttgggccgatgtacaag
cgggaccgggccctgaaacagcagaagaaggcacagattcgggccaatggcttcaagctg
gagacagggcccccgatgggggtgcccccgccgccccctcccgcaccggactacgtgctg
cctcccagcctgcatgggcctgagcccaagggcctggccgccggtccacctgctgggcca
ctgggcgactttggggccccagcactgcccatggccgtgcccggtgcccacgggccactg
gctggctacctctaccctgcctttcctggccgtgccatcaagtctgagtacccggagcct
tatgccagccccccacagcctgggctgccgtacggctacccagagcccttctctggaggg
cccaacgtgcctgagctcatcctgcagctgctgcagctggagccggatgaggaccaggtg
cgggcccgcatcttgggctgcctgcaggagcccaccaaaagccgccccgaccagccggcg
gccttcggcctcctgtgcagaatggccgaccagaccttcatctccatcgtggactgggca
cgcaggtgcatggtcttcaaggagctggaggtggccgaccagatgacgctgctgcagaac
tgctggagcgagctgctggtgttcgaccacatctaccgccaggtccagcacggcaaggag
ggcagcatcctgctggtcaccgggcaggaggtggagctgaccacagtggccacccaggcg
ggctcgctgctgcacagcctggtgttgcgggcgcaggagctggtgctgcagctgcttgcg
ctgcagctggaccggcaggagtttgtctgcctcaagttcatcatcctcttcagcctggat
ttgaagttcctgaataaccacatcctggtgaaagacgctcaggagaaggccaacgccgcc
ctgcttgactacaccctgtgccactacccgcactgcggggacaaattccagcagctgctg
ctgtgcctggtggaggtgcgggccctgagcatgcaggccaaggagtacctgtaccacaag
cacctgggcaacgagatgccccgcaacaacctgctcatcgaaatgctgcaagccaagcag
acttga

DBGET integrated database retrieval system