KEGG   Homo sapiens (human): 2517Help
Entry
2517              CDS       T01001                                 

Gene name
FUCA1, FUCA
Definition
fucosidase, alpha-L- 1, tissue (EC:3.2.1.51)
Orthology
K01206  
alpha-L-fucosidase [EC:3.2.1.51]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Lysosome
Disease
H00141  
Fucosidosis
H00422  
Glycoproteinoses
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:hsa00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34
AA seq 466 aa AA seqDB search
MRAPGMRSRPAGPALLLLLLFLGAAESVRRAQPPRRYTPDWPSLDSRPLPAWFDEAKFGV
FIHWGVFSVPAWGSEWFWWHWQGEGRPQYQRFMRDNYPPGFSYADFGPQFTARFFHPEEW
ADLFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYG
LYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYW
NSTNFLSWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCEDKFKPQSLPDHKWEMCTSID
KFSWGYRRDMALSDVTEESEIISELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGK
WLSINGEAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTK
ITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctccggggatgaggtcgcggccggcgggtcccgcgctgttgctgctgctgctc
ttcctcggagcggccgagtcggtgcgtcgggcccagcctccgcgccgctacaccccagac
tggccgagcctggattctcggccgctgccggcctggttcgacgaagccaagttcggggtg
ttcatccactggggcgtgttctcggtgcccgcctggggcagcgagtggttctggtggcac
tggcagggcgaggggcggccgcagtaccagcgcttcatgcgcgacaactacccgcccggc
ttcagctacgccgacttcggaccgcagttcactgcgcgcttcttccacccggaggagtgg
gccgacctcttccaggccgcgggcgccaagtatgtagttttgacgacaaagcatcacgaa
ggcttcacaaactggccgagtcctgtgtcttggaactggaactccaaagacgtggggcct
catcgggatttggttggtgaattgggaacagctctccggaagaggaacatccgctatgga
ctataccactcactcttagagtggttccatccactctatctacttgataagaaaaatggc
ttcaaaacacagcattttgtcagtgcaaaaacaatgccagagctgtacgaccttgttaac
agctataaacctgatctgatctggtctgatggggagtgggaatgtcctgatacttactgg
aactccacaaattttctttcatggctctacaatgacagccctgtcaaggatgaggtggta
gtaaatgaccgatggggtcagaactgttcctgtcaccatggaggatactataactgtgaa
gataaattcaagccacagagcttgccagatcacaagtgggagatgtgcaccagcattgac
aagttttcctggggctatcgtcgtgacatggcattgtctgatgttacagaagaatctgaa
atcatttcggaactggttcagacagtaagtttgggaggcaactatcttctgaacattgga
ccaactaaagatggactgattgttcccatcttccaagaaaggcttcttgctgttgggaaa
tggctgagcatcaatggggaggctatctatgcctccaaaccatggcgggtgcaatgggaa
aagaacacaacatctgtatggtatacctcaaagggatcggctgtttatgccatttttctg
cactggccagaaaatggagtcttaaaccttgaatcccccataactacctcaactacaaag
ataacaatgctgggaattcaaggagatctgaagtggtccacagatccagataaaggtctc
ttcatctctctaccccagttgccaccctctgctgtccccgcagagtttgcttggactata
aagctgacaggagtgaagtaa

DBGET integrated database retrieval system