KEGG   Homo sapiens (human): 2521Help
Entry
2521              CDS       T01001                                 

Gene name
FUS, ALS6, ETM4, FUS1, HNRNPP2, POMP75, TLS
Definition
(RefSeq) FUS RNA binding protein
  KO
K13098  RNA-binding protein FUS
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H01577  Essential tremor
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2521 (FUS)
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    2521 (FUS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RanBP RRM_1 Limkain-b1
Motif
Other DBs
NCBI-GeneID: 2521
NCBI-ProteinID: NP_004951
OMIM: 137070
HGNC: 4010
Ensembl: ENSG00000089280
Vega: OTTHUMG00000132395
Pharos: P35637(Tbio)
UniProt: P35637 Q6IBQ5
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 526 aa AA seqDB search
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaaacgattatacccaacaagcaacccaaagctatggggcctaccccacccag
cccgggcagggctattcccagcagagcagtcagccctacggacagcagagttacagtggt
tatagccagtccacggacacttcaggctatggccagagcagctattcttcttatggccag
agccagaacacaggctatggaactcagtcaactccccagggatatggctcgactggcggc
tatggcagtagccagagctcccaatcgtcttacgggcagcagtcctcctaccctggctat
ggccagcagccagctcccagcagcacctcgggaagttacggtagcagttctcagagcagc
agctatgggcagccccagagtgggagctacagccagcagcctagctatggtggacagcag
caaagctatggacagcagcaaagctataatccccctcagggctatggacagcagaaccag
tacaacagcagcagtggtggtggaggtggaggtggaggtggaggtaactatggccaagat
caatcctccatgagtagtggtggtggcagtggtggcggttatggcaatcaagaccagagt
ggtggaggtggcagcggtggctatggacagcaggaccgtggaggccgcggcaggggtggc
agtggtggcggcggcggcggcggcggtggtggttacaaccgcagcagtggtggctatgaa
cccagaggtcgtggaggtggccgtggaggcagaggtggcatgggcggaagtgaccgtggt
ggcttcaataaatttggtggccctcgggaccaaggatcacgtcatgactccgaacaggat
aattcagacaacaacaccatctttgtgcaaggcctgggtgagaatgttacaattgagtct
gtggctgattacttcaagcagattggtattattaagacaaacaagaaaacgggacagccc
atgattaatttgtacacagacagggaaactggcaagctgaagggagaggcaacggtctct
tttgatgacccaccttcagctaaagcagctattgactggtttgatggtaaagaattctcc
ggaaatcctatcaaggtctcatttgctactcgccgggcagactttaatcggggtggtggc
aatggtcgtggaggccgagggcgaggaggacccatgggccgtggaggctatggaggtggt
ggcagtggtggtggtggccgaggaggatttcccagtggaggtggtggcggtggaggacag
cagcgagctggtgactggaagtgtcctaatcccacctgtgagaatatgaacttctcttgg
aggaatgaatgcaaccagtgtaaggcccctaaaccagatggcccaggagggggaccaggt
ggctctcacatggggggtaactacggggatgatcgtcgtggtggcagaggaggctatgat
cgaggcggctaccggggccgcggcggggaccgtggaggcttccgagggggccggggtggt
ggggacagaggtggctttggccctggcaagatggattccaggggtgagcacagacaggat
cgcagggagaggccgtattaa

DBGET integrated database retrieval system