KEGG   Homo sapiens (human): 2523Help
Entry
2523              CDS       T01001                                 

Gene name
FUT1, H, HH, HSC
Definition
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) (EC:2.4.1.69)
Orthology
K00718  
galactoside 2-L-fucosyltransferase 1/2 [EC:2.4.1.69]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:hsa00601]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:hsa00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3
AA seq 365 aa AA seqDB search
MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGT
AMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAAL
APVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQ
IRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSA
YLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQC
NHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLW
TLAKP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccggagccatcgtcagctctgcctggccttcctgctagtctgtgtcctctct
gtaatcttcttcctccatatccatcaagacagctttccacatggcctaggcctgtcgatc
ctgtgtccagaccgccgcctggtgacacccccagtggccatcttctgcctgccgggtact
gcgatgggccccaacgcctcctcttcctgtccccagcaccctgcttccctctccggcacc
tggactgtctaccccaatggccggtttggtaatcagatgggacagtatgccacgctgctg
gctctggcccagctcaacggccgccgggcctttatcctgcctgccatgcatgccgccctg
gccccggtattccgcatcaccctgcccgtgctggccccagaagtggacagccgcacgccg
tggcgggagctgcagcttcacgactggatgtcggaggagtacgcggacttgagagatcct
ttcctgaagctctctggcttcccctgctcttggactttcttccaccatctccgggaacag
atccgcagagagttcaccctgcacgaccaccttcgggaagaggcgcagagtgtgctgggt
cagctccgcctgggccgcacaggggaccgcccgcgcacctttgtcggcgtccacgtgcgc
cgtggggactatctgcaggttatgcctcagcgctggaagggtgtggtgggcgacagcgcc
tacctccggcaggccatggactggttccgggcacggcacgaagcccccgttttcgtggtc
accagcaacggcatggagtggtgtaaagaaaacatcgacacctcccagggcgatgtgacg
tttgctggcgatggacaggaggctacaccgtggaaagactttgccctgctcacacagtgc
aaccacaccattatgaccattggcaccttcggcttctgggctgcctacctggctggcgga
gacactgtctacctggccaacttcaccctgccagactctgagttcctgaagatctttaag
ccggaggcggccttcctgcccgagtgggtgggcattaatgcagacttgtctccactctgg
acattggctaagccttga

DBGET integrated database retrieval system