KEGG   Homo sapiens (human): 252969Help
Entry
252969            CDS       T01001                                 

Gene name
NEIL2, NEH2, NEI2
Definition
nei endonuclease VIII-like 2 (E. coli) (EC:4.2.99.18)
Orthology
K10568  
endonuclease VIII-like 2 [EC:3.2.2.- 4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hsa03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p23.1
AA seq 332 aa AA seqDB search
MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDE
EMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLER
DAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNC
QLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYR
AGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKE
AFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagggccgttggtgaggaaatttcaccatttggtctccccctttgtgggtcag
caggtggtcaagacagggggcagcagtaagaagctacagcccgccagcctgcagtctctg
tggctccaggacacccaggtccatggaaagaaattattccttagatttgatctagatgaa
gaaatggggccccctggcagcagcccaacaccagagcctccacaaaaagaagtgcagaag
gaaggggctgcggacccaaagcaggtcggggagcccagcgggcagaagacccttgatgga
tcctcacggtctgcagagctcgtcccccagggcgaggatgattctgagtatttggagaga
gacgcccctgcaggagatgctgggaggtggctgcgtgtcagctttggtttgtttggcagc
gtttgggtgaacgatttctccagagccaagaaagccaacaagaggggggactggagggac
ccttccccgaggttggtcctgcactttggtggtggtggcttcctggcattttataattgt
cagttgtcttggagctcttccccagtggtcacacccacctgtgacatcctgtctgagaag
ttccatcgaggacaagccttagaagctctaggccaggctcagcctgtctgctatacactg
ctggaccagagatacttctcagggctagggaacatcattaagaatgaagccttgtacaga
gctgggatccatcccctttctctcggttcagtcctgagtgcctcgcgtcgggaggtcctg
gtggatcacgtggtggagttcagtacagcctggctgcagggcaagttccaaggcagaccg
cagcacacacaggtctaccagaaagaacagtgccctgctggccaccaggtcatgaaggag
gcgtttgggcccgaagatgggttacagaggctcacctggtggtgcccgcagtgccagccc
cagttgtcagaggagccagagcagtgccagttctcctaa

DBGET integrated database retrieval system