KEGG   Homo sapiens (human): 2531Help
Entry
2531              CDS       T01001                                 

Gene name
KDSR, DHSR, EKVP4, FVT1, SDR35C1
Definition
(RefSeq) 3-ketodihydrosphingosine reductase
  KO
K04708  3-dehydrosphinganine reductase [EC:1.1.1.102]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    2531 (KDSR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.102  3-dehydrosphinganine reductase
     2531 (KDSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Polysacc_synt_2 THF_DHG_CYH_C ATP_bind_2 TPD52 ADH_zinc_N ApbA 7kD_coat
Motif
Other DBs
NCBI-GeneID: 2531
NCBI-ProteinID: NP_002026
OMIM: 136440
HGNC: 4021
Ensembl: ENSG00000119537
Vega: OTTHUMG00000132792
Pharos: Q06136(Tbio)
UniProt: Q06136 A0A024R292
Position
18q21.33
AA seq 332 aa AA seqDB search
MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFIT
LVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVN
CAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGL
FGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISE
TTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLF
RTIALFYLGSFDSIVRRCMMQREKSENADKTA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctggctgccgccttcctcgtggccttcgtgctgctgctgtacatggtgtct
ccgctcatcagccccaagcccctcgccctgcccggggcgcatgtggtggttacaggaggt
tccagtggcatcgggaagtgcattgctatcgagtgctataaacaaggagcttttataact
ctggttgcacgaaatgaggataagctgctgcaggcaaagaaagaaattgaaatgcactct
attaatgacaaacaggtggtgctttgcatatcagttgatgtatctcaagactataaccaa
gtagagaatgtcataaaacaagcacaggagaaactgggtccagtggacatgctggtaaat
tgtgcaggaatggcagtgtcaggaaaatttgaagatcttgaagttagtacctttgaaagg
ttaatgagcatcaattacctgggcagcgtgtaccccagccgggccgtgatcaccaccatg
aaggagcgccgggtgggcaggatcgtgtttgtgtcctcccaggcaggacagttgggatta
ttcggtttcacagcctactctgcatccaagtttgccataaggggattggcagaagctttg
cagatggaggtgaagccatataatgtctacatcacagttgcttacccaccagacacagac
acacctggctttgccgaagaaaacagaacaaagcctttggagactcgacttatttcagag
accacatctgtgtgcaaaccagaacaggtggccaaacaaattgttaaagatgccatacaa
ggaaatttcaacagttcccttggctcagatgggtacatgctctcggccctgacctgtggg
atggctccagtaacttctattactgaggggctccagcaggtggtcaccatgggccttttc
cgcactattgctttgttttaccttggaagttttgacagcatagttcgtcgctgcatgatg
cagagagaaaaatctgaaaatgcagacaaaactgcctaa

DBGET integrated database retrieval system