KEGG   Homo sapiens (human): 2531Help
Entry
2531              CDS       T01001                                 

Gene name
KDSR, DHSR, FVT1, SDR35C1
Definition
3-ketodihydrosphingosine reductase (EC:1.1.1.102)
Orthology
K04708  
3-dehydrosphinganine reductase [EC:1.1.1.102]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    2531 (KDSR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.102  3-dehydrosphinganine reductase
     2531 (KDSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.3
AA seq 332 aa AA seqDB search
MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFIT
LVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVN
CAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGL
FGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISE
TTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLF
RTIALFYLGSFDSIVRRCMMQREKSENADKTA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctggctgccgccttcctcgtggccttcgtgctgctgctgtacatggtgtct
ccgctcatcagccccaagcccctcgccctgcccggggcgcatgtggtggttacaggaggt
tccagtggcatcgggaagtgcattgctatcgagtgctataaacaaggagcttttataact
ctggttgcacgaaatgaggataagctgctgcaggcaaagaaagaaattgaaatgcactct
attaatgacaaacaggtggtgctttgcatatcagttgatgtatctcaagactataaccaa
gtagagaatgtcataaaacaagcacaggagaaactgggtccagtggacatgctggtaaat
tgtgcaggaatggcagtgtcaggaaaatttgaagatcttgaagttagtacctttgaaagg
ttaatgagcatcaattacctgggcagcgtgtaccccagccgggccgtgatcaccaccatg
aaggagcgccgggtgggcaggatcgtgtttgtgtcctcccaggcaggacagttgggatta
ttcggtttcacagcctactctgcatccaagtttgccataaggggattggcagaagctttg
cagatggaggtgaagccatataatgtctacatcacagttgcttacccaccagacacagac
acacctggctttgccgaagaaaacagaacaaagcctttggagactcgacttatttcagag
accacatctgtgtgcaaaccagaacaggtggccaaacaaattgttaaagatgccatacaa
ggaaatttcaacagttcccttggctcagatgggtacatgctctcggccctgacctgtggg
atggctccagtaacttctattactgaggggctccagcaggtggtcaccatgggccttttc
cgcactattgctttgttttaccttggaagttttgacagcatagttcgtcgctgcatgatg
cagagagaaaaatctgaaaatgcagacaaaactgcctaa

DBGET integrated database retrieval system