KEGG   Homo sapiens (human): 253175Help
Entry
253175            CDS       T01001                                 

Gene name
CDY1B, CDY
Definition
chromodomain protein, Y-linked, 1B (EC:2.3.1.48)
Orthology
K00653  
histone acetyltransferase [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Drug target
Valproic acid: 
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     253175 (CDY1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Yq11.223
AA seq 540 aa AA seqDB search
MASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTE
KQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNRKLFAASKNVRR
KAASILSDTKNMEIINSTIETLAPDSPFDHKTVSGFQKLEKLDPIAADQQDTVVFKVTEG
KLLRDPLSRPGAEQTGIQNKTQIHPLMSQMSGSVTASMATGSATRKGIVVLIDPLAANGT
TDMHTSVPRVKGGQRNITDDSRDQPFIKKMHFTIRLTESASTYRDIVVKKEDGFTQIVLS
TRSTEKNALNTEVIKEIVNALNSAAADDSKLVLFSAAGSVFCCGLDFGYFVKHLRNNRNT
ASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTF
GQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIK
ELASYNPIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccaggagtttgaggttgaagctattgttgacaaaagacaggataaaaatggg
aatacacagtatttggttcggtggaaaggttatgacaaacaggatgacacttgggaacca
gagcagcacctcatgaactgtgaaaaatgtgtacatgattttaatagacgacagactgaa
aaacagaaaaaactgacatggactacaaccagtagaattttttcaaacaatgccagaaga
agaacttccagatctacaaaagcaaactattctaagaactctcctaaaacgccagtgact
gataaacaccacaggtccaaaaaccgcaagttatttgctgccagcaagaacgttaggaga
aaggcagcttcaattctctccgacacaaagaatatggagataataaattcaactattgag
acccttgcacctgacagcccctttgaccacaaaactgtgagtggctttcagaaacttgag
aaactggaccctattgcagcagatcagcaggacacggtggtcttcaaggtgacagaaggg
aaactcctccgggaccctttgtcacgtcctggtgcagaacagactggaatacagaacaag
actcagatacacccactaatgtcgcagatgtctggctcagttactgcttctatggccaca
ggttcagctacccgaaagggtatagtggtattaatagacccattagcagccaatgggaca
acagacatgcatacctcagttccaagagtgaaaggtgggcaaagaaatattactgatgac
agcagagaccagccttttatcaagaagatgcacttcaccataaggctaacagaaagtgcc
agcacatacagagacattgtagtgaagaaagaggatggattcacccagatagtgctatca
actagatcgacagaaaaaaatgcactgaatacagaagtaattaaagaaatagttaatgct
ctgaatagcgctgctgcagatgacagcaagctcgtgctgttcagtgcagctggaagtgtc
ttttgctgcggtcttgattttgggtactttgtgaagcacttaaggaataacagaaacaca
gcaagccttgaaatggtggacaccatcaagaactttgtgaatacttttattcaatttaaa
aagcctattgttgtatcagtcaatggccctgcgattggactaggtgcatccatcctgcct
ctttgtgatctcgtgtgggctaatgaaaaggcttggttccaaaccccttatacgaccttt
ggacagagtccagatggctgttcttctattacattccccaaaatgatgggtaaagcatct
gccaatgaaatgttaattgctgggcgaaagctgacagcaagggaggcatgcgccaaaggc
ctggtctctcaggtatttttgactggaactttcacccaagaggttatgattcaaattaag
gagcttgcctcatacaatccaattgtactggaagaatgtaaggccctcgttcgctgtaat
attaagttggagttggaacaggccaatgagagagagtgtgaggtgctgaggaagatctgg
agctcagcccaagggatagaatccatgttaaagtatgttgaaaataaaattgatgagttt
taa

DBGET integrated database retrieval system