KEGG   Homo sapiens (human): 253260Help
Entry
253260            CDS       T01001                                 

Gene name
RICTOR, AVO3, PIA, hAVO3
Definition
RPTOR independent companion of MTOR, complex 2
Orthology
K08267  
rapamycin-insensitive companion of mTOR
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p13.1
AA seq 1732 aa AA seqDB search
MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHL
NNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSILQKV
LKLKVDYLIARCIDIQQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQER
DRMVRACIAIICELALQNPEVVALRGGLNTILKNVIDCQLSRINEALITTILHLLNHPKT
RQYVRADVELERILAPYTDFHYRHSPDTAEGQLKEDREARFLASKMGIIATFRSWAGIIN
LCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVTEEFIEALLSVDPGRFQD
SWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHIS
VRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFH
EMKKRGPKPYSLHLDHIIQKAIATHQKRDQYLRVQKDIFILKDTEEALLINLRDSQVLQH
KENLEWNWNLIGTILKWPNVNLRNYKDEQLHRFVRRLLYFYKPSSKLYANLDLDFAKAKQ
LTVVGCQFTEFLLESEEDGQGYLEDLVKDIVQWLNASSGMKPERSLQNNGLLTTLSQHYF
LFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKLTVSSLDYSRDGLARVILSKI
LTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACED
KANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKYV
DLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQN
IITELCRNVRTPDLDKWEEIKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCE
VLSIRGTCVYVLGLIAKTKQGCDILKCHNWDAVRHSRKHLWPVVPDDVEQLCNELSSIPS
TLSLNSESTSSRHNSESESVPSSMFILEDDRFGSSSTSTFFLDINEDTEPTFYDRSGPIK
DKNSFPFFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTLTEPSVD
FNHSDDFTPISTVQKTLQLETSFMGNKHIEDTGSTPSIGENDLKFTKNFGTENHRENTSR
ERLVVESSTSSHMKIRSQSFNTDTTTSGISSMSSSPSRETVGVDATTMDTDCGSMSTVVS
TKTIKTSHYLTPQSNHLSLSKSNSVSLVPPGSSHTLPRRAQSLKAPSIATIKSLADCNFS
YTSSRDAFGYATLKRLQQQRMHPSLSHSEALASPAKDVLFTDTITMKANSFESRLTPSRI
DFKKKHVGGIRSLRPTITNNLFRFMKALSYASLDKEDLLSPINQNTLQRSSSVRSMVSSA
TYGGSDDYIGLALPVDINDIFQVKDIPYFQTKNIPPHDDRGARAFAHDAGGLPSGTGGLV
KNSFHLLRQQMSLTEIMNSIHSDASLFLESTEDTGLQEHTDDNCLYCVCIEILGFQPSNQ
LSAICSHSDFQDIPYSDWCEQTIHNPLEVVPSKFSGISGCSDGVSQEGSASSTKSTELLL
GVKTIPDDTPMCRILLRKEVLRLVINLSSSVSTKCHETGLLTIKEKYPQTFDDICLYSEV
SHLLSHCTFRLPCRRFIQELFQDVQFLQMHEEAEAVLATPPKQPIVDTSAES
NT seq 5199 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatcggccgcggccgctctctgaagaacctccgagtacgagggcggaatgac
agcggcgaggagaacgtcccgctggatctgacccgagaaccttctgataacttaagagag
attctccaaaatgtggccagattgcagggagtatcaaatatgagaaagctaggccatctg
aataactttactaagcttctttgtgatattggccacagtgaagaaaaactgggctttcac
tatgaggatatcataatttgtttgcggttagctttattaaatgaagcaaaagaagtgcga
gcagcagggctacgagcgcttcgatatctcatccaagactccagtattctccagaaggtg
ctaaaattgaaagtggactatttaatagctaggtgcattgacatacaacagagcaacgag
gtagagaggacacaagcacttcgattagtcagaaagatgattactgtgaatgcttccttg
tttcctagttctgtgaccaactcattaattgcagttggaaatgatggacttcaagaaaga
gacagaatggtccgagcatgcattgccattatctgtgaactagcacttcagaatccagag
gtggtggcccttcgaggtggactaaacaccatcttgaaaaatgtgatcgattgccaatta
agtcgaataaatgaggccctaattactacaattttgcaccttcttaatcatccaaagact
cgacagtatgtgcgagctgatgtagaattagagagaattttagcaccctatactgatttt
cactacagacatagtccagatacagctgaaggacagctcaaagaagacagagaagcacga
tttctagccagtaaaatgggaatcatagcaacattccgatcatgggcaggtattattaat
ttatgtaaacctggaaattctgggatccagtctctaataggagtactttgcataccaaat
atggaaataaggcgaggtctacttgaagtgctttatgatatatttcgtcttcctctacct
gttgtgactgaggagttcatagaagcactactcagtgtagatccagggaggttccaagac
agttggaggctttcagatggctttgtggcagctgaggcaaaaactattcttcctcatcgt
gccagatccaggccagacctcatggataattatttggcactgatactctctgcatttatt
cgtaatggacttttagagggtctagttgaagtgataacaaacagtgatgatcatatctca
gttagagctaccatccttttaggagagcttttacatatggcaaacacaattcttcctcat
tcacatagccatcatttacactgcttgccaaccctaatgaatatggctgcatcctttgat
atccccaaggaaaagagactgcgagccagtgcagccttgaactgtttaaaacgcttccat
gaaatgaagaaacgaggacctaagccttatagtcttcatttagaccacattattcagaaa
gcaattgcaacacaccagaaacgggatcagtatctccgagttcagaaagatatatttatc
cttaaggatacagaggaagctcttttaattaaccttagagatagccaagtccttcaacat
aaagagaatcttgaatggaattggaatcttatagggaccattcttaagtggccaaatgta
aatctaagaaactataaagatgaacagttacacaggtttgtacgaagactactttatttt
tacaagcccagcagtaaattatatgccaacctggatctggattttgccaaggccaaacag
ctcacggttgtaggttgccagtttacagaatttcttcttgaatctgaagaggatgggcaa
ggctacttagaagatctagtaaaggatattgttcagtggctcaatgcttcatctggaatg
aaacccgaaagaagtcttcaaaataatggtttattgaccacccttagtcaacactacttt
ttatttattggaacactttcttgccaccctcatggagttaaaatgctggaaaaatgcagt
gtatttcagtgtctccttaatctttgctccttgaaaaaccaagatcacttgctaaaactt
actgtttctagcttggactatagcagagatggattggctagagtcatcctttccaaaatt
ttaactgcagctactgatgcctgcagactctatgcaacaaaacatttaagggtattattg
agagctaatgttgaattctttaataattggggaattgagttgttagtgacccagctacat
gataaaaacaaaacgatttcctctgaagctcttgatatcctcgatgaagcatgtgaagac
aaggccaatcttcatgctctcattcagatgaaaccagcgttatcccaccttggagacaag
ggtttgcttctcctgctgagatttctctccattccaaaaggattttcctatctgaatgaa
agaggttatgtagcaaaacaattggaaaagtggcacagggaatacaactccaaatatgtt
gacttgattgaggaacaactcaatgaagcacttactacttaccggaagcctgttgatggt
gataactatgttcgtcggagtaaccaaagattacagcgtcctcacgtctacctgcctata
cacctttatggacaactagtacaccataaaacaggctgccatttgttggaagtacagaat
attattacagaactctgtcgtaatgttcgtacaccagatttggataagtgggaagaaatt
aaaaaactgaaagcatctctttgggccttgggaaatatcggctcatcaaattggggtctc
aatttgctacaggaagaaaacgtgattccagatatactaaaacttgcaaaacagtgtgaa
gttctttccatcagagggacctgtgtatatgtacttgggctcatagctaaaaccaaacaa
ggctgtgatattctaaaatgtcacaactgggatgctgtgaggcatagtcgcaaacatctg
tggccagtggttccagatgatgtggaacaactctgtaatgaactttcatctatcccaagc
actctaagtttgaactcggagtcaaccagctctagacataatagtgaaagtgaatctgtg
ccatcgagtatgttcatattggaggatgaccggtttggcagcagctctactagtacattt
ttccttgatatcaatgaagatacagagccaacattttatgaccgatctggacccataaag
gataaaaattcattccctttctttgcttctagtaaacttgtgaagaatcgtatcttaaat
tcgcttactttgcctaacaaaaaacatcgtagtagcagtgatccaaaaggagggaaatta
tcatctgaaagtaagacaagcaacaggcgaatcagaacacttacggagcccagtgttgat
tttaatcatagtgatgattttacacccatatccactgtacagaaaacattacaattagag
acttcatttatggggaataagcacattgaagacactggtagtacaccaagcattggagaa
aatgacttaaaattcaccaagaattttggtacagagaatcacagagaaaatacaagccga
gagaggttagtagtagaaagttcaacgagctcacatatgaagatacgtagccaaagtttc
aatacagacactacaacaagtggcataagttcaatgagctcaagtccttcacgagagaca
gtaggtgtagatgctacaactatggacacagactgtggaagcatgagtactgtggtaagt
actaaaactattaagacaagccactatttgacgccacagtctaaccatctgtctctctcc
aaatcaaattcggtgtccctggtgcctccaggttcttctcatacgcttcctagaagagca
cagtcccttaaagcaccctctattgctacaattaaaagtctagcagattgtaactttagt
tacacaagttctagagatgcttttggctatgctacactgaaaagactacagcaacaaaga
atgcatccatccttatctcactctgaagctttggcatctccagcaaaagatgtgctattt
actgataccatcaccatgaaggccaacagttttgagtccagattaacaccaagcaggatc
gattttaaaaagaagcatgtcgggggaatcaggagcttaagacctacaataacaaacaac
cttttcaggttcatgaaagccttaagttatgcatcattagataaagaagatttattgagt
cctattaatcaaaataccctgcaacgatcttcctcagtgcggtccatggtgtccagtgcc
acatatgggggttcagatgattacattggtcttgctctcccggtggatataaatgatata
ttccaggtaaaggatattccctattttcagacaaaaaacataccaccacatgatgatcga
ggtgcaagagcatttgcccatgatgcaggaggtcttccatctggaactggaggtcttgta
aaaaattcttttcacttgctacgacagcagatgagtcttacggaaataatgaattcaatc
cattcagatgcctctctgtttttagaaagtacagaagacactggactacaggaacataca
gatgataactgcctttattgtgtctgtattgaaattctgggtttccagcccagcaaccaa
ctgagtgcaatatgtagtcattcagactttcaagatattccatattctgattggtgtgag
cagactatccataatcctttagaagtggttccctctaagttttcggggatttctggatgc
agtgatggggtgtctcaagaaggctcagctagcagcaccaaaagcacagaattgttacta
ggtgttaaaacaattccagatgatacaccaatgtgccgtatactccttcgcaaagaagtt
ctaagattagtcattaatttgagtagttcagtttcaactaaatgtcatgagactgggctt
ttaacaattaaggagaagtatcctcaaacatttgatgacatatgcctttactctgaggtt
tcccatttgctgtcacactgcacattcagacttccgtgtcggaggttcatacaagaatta
tttcaagatgtacagtttctacaaatgcatgaagaagcagaggctgtgttggcaacacca
ccaaagcaacctatagttgatacatctgctgaatcctga

DBGET integrated database retrieval system