KEGG   Homo sapiens (human): 2547Help
Entry
2547              CDS       T01001                                 

Gene name
XRCC6, CTC75, CTCBF, G22P1, KU70, ML8, TLAA
Definition
(RefSeq) X-ray repair complementing defective repair in Chinese hamster cells 6
  KO
K10884  
ATP-dependent DNA helicase 2 subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
Non-homologous end-joining
Module
DNA-PK complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    2547 (XRCC6)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    2547 (XRCC6)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     2547 (XRCC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.2
AA seq 609 aa AA seqDB search
MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPF
DMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELD
QFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDS
AKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLE
DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKT
RTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHH
YLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEEL
DDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN
PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKV
TKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL
EALTKHFQD
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggtgggagtcatattacaaaaccgagggcgatgaagaagcagaggaagaacaa
gaagagaaccttgaagcaagtggagactataaatattcaggaagagatagtttgattttt
ttggttgatgcctccaaggctatgtttgaatctcagagtgaagatgagttgacacctttt
gacatgagcatccagtgtatccaaagtgtgtacatcagtaagatcataagcagtgatcga
gatctcttggctgtggtgttctatggtaccgagaaagacaaaaattcagtgaattttaaa
aatatttacgtcttacaggagctggataatccaggtgcaaaacgaattctagagcttgac
cagtttaaggggcagcagggacaaaaacgtttccaagacatgatgggccacggatctgac
tactcactcagtgaagtgctgtgggtctgtgccaacctctttagtgatgtccaattcaag
atgagtcataagaggatcatgctgttcaccaatgaagacaacccccatggcaatgacagt
gccaaagccagccgggccaggaccaaagccggtgatctccgagatacaggcatcttcctt
gacttgatgcacctgaagaaacctgggggctttgacatatccttgttctacagagatatc
atcagcatagcagaggatgaggacctcagggttcactttgaggaatccagcaagctagaa
gacctgttgcggaaggttcgcgccaaggagaccaggaagcgagcactcagcaggttaaag
ctgaagctcaacaaagatatagtgatctctgtgggcatttataatctggtccagaaggct
ctcaagcctcctccaataaagctctatcgggaaacaaatgaaccagtgaaaaccaagacc
cggacctttaatacaagtacaggcggtttgcttctgcctagcgataccaagaggtctcag
atctatgggagtcgtcagattatactggagaaagaggaaacagaagagctaaaacggttt
gatgatccaggtttgatgctcatgggtttcaagccgttggtactgctgaagaaacaccat
tacctgaggccctccctgttcgtgtacccagaggagtcgctggtgattgggagctcaacc
ctgttcagtgctctgctcatcaagtgtctggagaaggaggttgcagcattgtgcagatac
acaccccgcaggaacatccctccttattttgtggctttggtgccacaggaagaagagttg
gatgaccagaaaattcaggtgactcctccaggcttccagctggtctttttaccctttgct
gatgataaaaggaagatgccctttactgaaaaaatcatggcaactccagagcaggtgggc
aagatgaaggctatcgttgagaagcttcgcttcacatacagaagtgacagctttgagaac
cccgtgctgcagcagcacttcaggaacctggaggccttggccttggatttgatggagccg
gaacaagcagtggacctgacattgcccaaggttgaagcaatgaataaaagactgggctcc
ttggtggatgagtttaaggagcttgtttacccaccagattacaatcctgaagggaaagtt
accaagagaaaacacgataatgaaggttctggaagcaaaaggcccaaggtggagtattca
gaagaggagctgaagacccacatcagcaagggtacgctgggcaagttcactgtgcccatg
ctgaaagaggcctgccgggcttacgggctgaagagtgggctgaagaagcaggagctgctg
gaagccctcaccaagcacttccaggactga

DBGET integrated database retrieval system