KEGG   Homo sapiens (human): 254783Help
Entry
254783            CDS       T01001                                 

Gene name
OR6C74
Definition
olfactory receptor, family 6, subfamily C, member 74
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    254783 (OR6C74)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    254783 (OR6C74)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.2
AA seq 312 aa AA seqDB search
MRNHTTVANFILLGLTDDPQLQVIIFLLLFFTYMLSITGNLTIITLTLLDLHLKTPMYFF
LRNFSFLEVSFTTVYIPKFLVSMATGDKTISYNDCAAQLFFTILLGATEFFLLAAMSYER
YVAICKPLHYTTIMSSRVCSLLVFASWMAGFLIIFPPLLMGLQLDFCAANTVDHFFCDVS
PILQLSCTDTDIIELMMLLSAILTLLVTLVLVILSYTNIIRTILKIPSSQQRKKAFSTCS
SHMVVVSISYGSCIFMYVKPSAKERVSLNKGIALLSTSVAPMLNPFIYTLRNKQVKDVFK
HTVKKIELFSMK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaccatacaacagtagcaaactttattcttcttggactgacagatgatccacaa
ttacaggtgattatttttcttctcctttttttcacctacatgttgagcatcactgggaat
ctaaccatcatcactctcaccctactggatttgcatctcaagacacccatgtatttcttc
ctccgaaatttctcatttttagaagtctcattcacaactgtctacattcccaaatttctt
gttagtatggcaacaggtgataagaccatttcttacaacgattgtgcagcacagctgttt
ttcactattctcttgggggcaactgaattttttcttctggctgccatgtcctatgagcgc
tatgtggccatctgcaaacccctgcattacaccaccatcatgagcagcagagtttgcagc
ttgctggtctttgcttcatggatggctggcttcctaataatttttccgccactcctgatg
ggtctccagcttgatttctgtgcagccaacactgtagatcatttcttctgtgatgtttct
cctatactgcagctctcttgcacagacactgacataatagaattaatgatgcttctctca
gccattttgacgctcctggttacactggtattagtgattctctcctacacaaatattatc
aggactattctgaaaataccttcttctcaacagagaaaaaaagcattttctacatgttct
tcccacatggtggtcgtgtccatttcttatggcagctgcatcttcatgtatgtgaaaccc
tcagcaaaagaaagagtgtcattaaataaagggatagctctgctcagcacttctgttgcc
cccatgttgaatccctttatttatacactgagaaacaaacaagtaaaagatgtttttaag
cacacagtcaaaaagattgaacttttctcaatgaaatga

DBGET integrated database retrieval system